Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.25
PubTator Score 5.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.266 7.2e-13
Atopic dermatitis -1.500 1.4e-03
Breast cancer -3.100 2.5e-02
breast carcinoma -1.800 2.8e-05
Chronic Lymphocytic Leukemia 2.346 7.7e-05
colon cancer -3.000 5.1e-06
ductal carcinoma in situ -2.800 5.5e-05
fibroadenoma -2.000 3.5e-03
invasive ductal carcinoma -1.415 3.1e-03
lung adenocarcinoma -1.400 1.5e-08
lung cancer -1.800 1.9e-03
lung carcinoma -1.800 4.5e-10
malignant mesothelioma -5.700 3.3e-10
mucosa-associated lymphoid tissue lympho... 1.146 1.7e-02
non-small cell lung cancer -1.441 3.6e-23
osteosarcoma -2.098 4.6e-02
pancreatic ductal adenocarcinoma liver m... -1.637 7.4e-03
psoriasis -1.200 1.1e-03

Gene RIF (9)

AA Sequence

MNMKQKSVYQQTKALLCKNFLKKWRMKRESLLEWGLSILLGLCIALFSSSMRNVQFPGMAPQNLGRVDKF      1 - 70
NSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFF     71 - 140
QGYNSPLWKEDFSAHCWDGYGEFSCTLTKYWNRGFVALQTAINTAIIEITTNHPVMEELMSVTAITMKTL    141 - 210
PFITKNLLHNEMFILFFLLHFSPLVYFISLNVTKERKKSKNLMKMMGLQDSAFWLSWGLIYAGFIFIISI    211 - 280
FVTIIITFTQIIVMTGFMVIFILFFLYGLSLVALVFLMSVLLKKAVLTNLVVFLLTLFWGCLGFTVFYEQ    281 - 350
LPSSLEWILNICSPFAFTTGMIQIIKLDYNLNGVIFPDPSGDSYTMIATFSMLLLDGLIYLLLALYFDKI    351 - 420
LPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYFEPVAPEFQGKEAIRIRNVKKEYKGK    421 - 490
SGKVEALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTIYNKNLSEMQDLEEIRKITGV    491 - 560
CPQFNVQFDILTVKENLSLFAKIKGIHLKEVEQEVQRILLELDMQNIQDNLAKHLSEGQKRKLTFGITIL    561 - 630
GDPQILLLDEPTTGLDPFSRDQVWSLLRERRADHVILFSTQSMDEADILADRKVIMSNGRLKCAGSSMFL    631 - 700
KRRWGLGYHLSLHRNEICNPEQITSFITHHIPDAKLKTENKEKLVYTLPLERTNTFPDLFSDLDKCSDQG    701 - 770
VTGYDISMSTLNEVFMKLEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVSDMGLWRMQVFAM    771 - 840
ARLRFLKLKRQTKVLLTLLLVFGIAIFPLIVENIMYAMLNEKIDWEFKNELYFLSPGQLPQEPRTSLLII    841 - 910
NNTESNIEDFIKSLKHQNILLEVDDFENRNGTDGLSYNGAIIVSGKQKDYRFSVVCNTKRLHCFPILMNI    911 - 980
ISNGLLQMFNHTQHIRIESSPFPLSHIGLWTGLPDGSFFLFLVLCSISPYITMGSISDYKKNAKSQLWIS    981 - 1050
GLYTSAYWCGQALVDVSFFILILLLMYLIFYIENMQYLLITSQIVFALVIVTPGYAASLVFFIYMISFIF   1051 - 1120
RKRRKNSGLWSFYFFFASTIMFSITLINHFDLSILITTMVLVPSYTLLGFKTFLEVRDQEHYREFPEANF   1121 - 1190
ELSATDFLVCFIPYFQTLLFVFVLRCMELKCGKKRMRKDPVFRISPQSRDAKPNPEEPIDEDEDIQTERI   1191 - 1260
RTATALTTSILDEKPVIIASCLHKEYAGQKKSCFSKRKKKIAARNISFCVQEGEILGLLGPNGAGKSSSI   1261 - 1330
RMISGITKPTAGEVELKGCSSVLGHLGYCPQENVLWPMLTLREHLEVYAAVKGLRKADARLAIARLVSAF   1331 - 1400
KLHEQLNVPVQKLTAGITRKLCFVLSLLGNSPVLLLDEPSTGIDPTGQQQMWQAIQAVVKNTERGVLLTT   1401 - 1470
HNLAEAEALCDRVAIMVSGRLRCIGSIQHLKNKLGKDYILELKVKETSQVTLVHTEILKLFPQAAGQERY   1471 - 1540
SSLLTYKLPVADVYPLSQTFHKLEAVKHNFNLEEYSLSQCTLEKVFLELSKEQEVGNFDEEIDTTMRWKL   1541 - 1610
LPHSDEP                                                                  1611 - 1617
//

Text Mined References (18)

PMID Year Title