Property Summary

NCBI Gene PubMed Count 80
PubMed Score 71.82
PubTator Score 69.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Colitis, Ulcerative 59 0.0 0.0
Disease Target Count
ulcerative colitis 1819
Disease Target Count P-value
osteosarcoma 7950 9.8e-04
Disease Target Count Z-score Confidence
Asthma 385 5.743 2.9
Disease Target Count Z-score Confidence
Retinitis pigmentosa 26 5 3.448 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.646 9.8e-04

Gene RIF (68)

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT      1 - 70
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP     71 - 140
QLHGVRIFGINKY                                                             141 - 153
//

Text Mined References (80)

PMID Year Title