Property Summary

NCBI Gene PubMed Count 69
Grant Count 17
R01 Count 12
Funding $2,069,740.29
PubMed Score 63.03
PubTator Score 69.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.646 0.001

Gene RIF (57)

PMID Text
27097577 The SNP (rs7216389) of ORMDL3 does not influence the expression of OPN and TGF-beta1, suggesting that it may not be associated with airway remodeling.
26782568 The TT homozygote and the T allele of rs7216389 in ORMDL3 increased bronchiolitis risk. The rs7216389 polymorphism may be a predictor for identifying infants with predisposition to virus-induced wheezing to persistent asthma.
26603569 Two single nucleotide polymorphisms regulating ORMDL3 expression (rs7216389 and rs9303277) significantly associated with atherosclerosis risk and the evidence of increased ORMDL3 expression in AS cases compared to controls.
26270739 ORMDL3 variants have been shown to be associated with Asthma in children with Rhinovirus infections -induced wheezing illnesses.
26125920 The meta-analysis indicates that ORMDL3 rs7216389 may contribute to increasing susceptibility to asthma. (Meta-analysis)
26112603 results show that Cbl-b suppresses human ORMDL3 expression through STAT6
25930191 genetic polymorphisms are associated with childhood asthma, and with changes in TH2 cytokines levels
25815492 Pro-inflammatory gene ORMDL3 SNP rs12603332 may be associated with high LysoPC and apoB levels, which leads to the occurrence of childhood asthma.
25691431 the contribution of ORMDL3 to asthma risk may involve changes in sphingolipid metabolism
25395622 Expression of the ORMDLS, modulators of serine palmitoyltransferase, is regulated by sphingolipids in mammalian cells.
More...

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT      1 - 70
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP     71 - 140
QLHGVRIFGINKY                                                             141 - 153
//

Text Mined References (69)

PMID Year Title
27097577 2016 [ORMDL3 polymorphisms and their relationship with OPN and TGF-?1 levels in children with asthma in Hunan, China: an analysis of 98 cases].
26782568 2015 ORMDL3 variants associated with bronchiolitis susceptibility in a Chinese population.
26603569 2015 ORMDL3 contributes to the risk of atherosclerosis in Chinese Han population and mediates oxidized low-density lipoprotein-induced autophagy in endothelial cells.
26270739 2015 Rhinovirus in the Pathogenesis and Clinical Course of Asthma.
26125920 2015 Correlation between the genetic polymorphism of ORMDL3 gene and asthma risk: a meta-analysis.
26112603 2015 E3 ubiquitin ligase Cbl-b suppresses human ORMDL3 expression through STAT6 mediation.
25930191 2015 Polymorphisms related to ORMDL3 are associated with asthma susceptibility, alterations in transcriptional regulation of ORMDL3, and changes in TH2 cytokine levels.
25815492 2015 [Association of ORMDL3 single nucleotide polymorphisms with lysophosphatidylcholine and apolipoprotein B levels in children with asthma].
25691431 2015 ORMDL/serine palmitoyltransferase stoichiometry determines effects of ORMDL3 expression on sphingolipid biosynthesis.
25395622 2015 Expression of the ORMDLS, modulators of serine palmitoyltransferase, is regulated by sphingolipids in mammalian cells.
More...