Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.92
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.7e-13
ependymoma 4679 1.1e-11
nasopharyngeal carcinoma 1058 9.7e-06
medulloblastoma 720 1.6e-05
lung carcinoma 2843 4.5e-05
astrocytic glioma 2597 8.6e-03
facioscapulohumeral dystrophy 288 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 2.3

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 8.6e-03
ependymoma 4.000 1.1e-11
facioscapulohumeral dystrophy -1.900 4.4e-02
lung carcinoma -1.400 4.5e-05
medulloblastoma -1.200 1.6e-05
nasopharyngeal carcinoma -2.300 9.7e-06
psoriasis -1.500 1.7e-13

Gene RIF (1)

AA Sequence

MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRL      1 - 70
QEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAI     71 - 140
AFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGE    141 - 210
EVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGS    211 - 280
MDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISK    281 - 350
ISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR         351 - 415
//

Text Mined References (10)

PMID Year Title