Property Summary

NCBI Gene PubMed Count 8
Grant Count 9
R01 Count 9
Funding $534,928.5
PubMed Score 5.08
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 0.009
posterior fossa group B ependymoma 5.000 0.000
medulloblastoma -1.200 0.000
nasopharyngeal carcinoma -2.300 0.000
lung carcinoma -1.400 0.000
psoriasis -1.500 0.000
facioscapulohumeral dystrophy -1.900 0.044

Gene RIF (1)

PMID Text
16093345 This paper describes a Chlamydmonas reinhardtii protein with 70% similarity to human WD repeat domain 69 protein. The protein is expressed in flagella and required for assembly of the flagellar outer row dynein ATPase, though it is not a dynein subunit.

AA Sequence

MKLKSLLLRYYPPGIMLEYEKHGELKTKSIDLLDLGPSTDVSALVEEIQKAEPLLTASRTEQVKLLIQRL      1 - 70
QEKLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAI     71 - 140
AFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGE    141 - 210
EVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGS    211 - 280
MDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISK    281 - 350
ISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIWR         351 - 415
//

Text Mined References (10)

PMID Year Title
21953912 2011 A unified taxonomy for ciliary dyneins.
20568242 2010 Oda16/Wdr69 is essential for axonemal dynein assembly and ciliary motility during zebrafish embryogenesis.
18852297 2008 ODA16 aids axonemal outer row dynein assembly through an interaction with the intraflagellar transport machinery.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16093345 2005 ODA16p, a Chlamydomonas flagellar protein needed for dynein assembly.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.