Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.55
PubTator Score 4.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 5.24342787187375E-11
posterior fossa group B ependymoma 1530 1.20200384550473E-9
glioblastoma 5572 1.8125125393203E-7
Duchenne muscular dystrophy 602 3.01967385835603E-7
pediatric high grade glioma 2712 4.53798096928507E-5
acute quadriplegic myopathy 1157 8.89305408541271E-5
sonic hedgehog group medulloblastoma 1482 1.57908455421368E-4
psoriasis 6685 1.89752999744667E-4
Breast cancer 3099 1.96643518185131E-4
lung adenocarcinoma 2714 2.56628749940505E-4
osteosarcoma 7933 3.04793157357361E-4
Multiple myeloma 1328 5.58046778768511E-4
pilocytic astrocytoma 3086 5.68137989081019E-4
ovarian cancer 8492 5.76411782603901E-4
atypical teratoid/rhabdoid tumor 1095 6.74112070879358E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00124610664756387
Down syndrome 548 0.00152242206807224
dermatomyositis 967 0.00281544716886396
primitive neuroectodermal tumor 3031 0.00368668950888107
Waldenstrons macroglobulinemia 765 0.0291087876059085

Expression

Synonym

Accession Q8N131 Q8IWS2 Q96QV2
Symbols KCT3
PORMIN
PORIMIN

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid

 MGI Term (1)

Pathway (1)

AA Sequence

MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNST      1 - 70
VKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSS     71 - 140
VTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII      141 - 208
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24318988 2014 FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12752121 2003 Identification of novel genes for secreted and membrane-anchored proteins in human keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...