Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.55
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.049 8.9e-05
adult high grade glioma 1.200 1.6e-02
Astrocytoma, Pilocytic 1.300 1.3e-04
atypical teratoid/rhabdoid tumor 1.200 6.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.296 1.2e-03
Breast cancer 1.200 2.0e-04
dermatomyositis 2.000 2.8e-03
Down syndrome 1.600 1.5e-03
Duchenne muscular dystrophy 1.246 3.0e-07
ependymoma 1.900 3.0e-12
glioblastoma 1.500 1.8e-07
juvenile dermatomyositis 1.513 5.2e-11
lung adenocarcinoma 1.015 2.6e-04
Multiple myeloma 1.965 5.6e-04
osteosarcoma 1.471 3.0e-04
ovarian cancer -1.300 5.8e-04
primitive neuroectodermal tumor 1.100 3.7e-03
psoriasis 1.600 1.9e-04
sonic hedgehog group medulloblastoma 1.900 1.6e-04
Waldenstrons macroglobulinemia 1.240 2.9e-02

AA Sequence

MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPSDHTNETSNST      1 - 70
VKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTSVSQNTSQISTSTMTVTHNSS     71 - 140
VTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRTIDEHDAII      141 - 208
//

Text Mined References (15)

PMID Year Title