Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.73
PubTator Score 1.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.300 0.001
adult high grade glioma -1.100 0.004
ovarian cancer -1.700 0.000

Gene RIF (2)

PMID Text
22447933 a mechanism for the differential trafficking of TLR1 I602S variants, and highlight the distinct roles for PRAT4A and PRAT4B in the regulation of TLR1 surface expression.
16338228 A PRotein Associated with Tlr4 (PRAT4B), regulates cell surface expression of TLR4. PRAT4B has a signal peptide followed by a mature peptide. PRAT4B is associated with the hypoglycosylated, immature form of TLR4 but not with MD-2 or TLR2.

AA Sequence

MGPVRLGILLFLFLAVHEAWAGMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDT      1 - 70
GKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLE     71 - 140
LWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGE    141 - 210
EKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL                                    211 - 248
//

Text Mined References (7)

PMID Year Title
22447933 2012 Cell surface trafficking of TLR1 is differentially regulated by the chaperones PRAT4A and PRAT4B.
16338228 2006 A molecule that is associated with Toll-like receptor 4 and regulates its cell surface expression.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.