Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.04
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
interstitial lung disease -1.200 0.005
osteosarcoma 1.626 0.001
juvenile dermatomyositis 1.143 0.000
primary pancreatic ductal adenocarcinoma 1.043 0.002
tuberculosis -3.300 0.000
diabetes mellitus -1.400 0.001
group 4 medulloblastoma 1.100 0.002
pilocytic astrocytoma 1.200 0.000
Endometriosis -1.460 0.015
ovarian cancer 1.100 0.045

Gene RIF (1)

PMID Text
19663910 Remarkable repression of c14orf24 by miR124a was detected during neurogenesis.

AA Sequence

MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS      1 - 70
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY     71 - 140
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS    141 - 210
VPP                                                                       211 - 213
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19663910 2009 Noninvasive imaging of microRNA124a-mediated repression of the chromosome 14 ORF 24 gene during neurogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...