Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.04
PubTator Score 1.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 9.66178967489003E-11
tuberculosis 1563 2.8775047191204E-8
pilocytic astrocytoma 3086 4.31999349342715E-5
osteosarcoma 7933 5.81315720612762E-4
diabetes mellitus 1663 0.00139373707069883
primary pancreatic ductal adenocarcinoma 1271 0.00206562043586091
group 4 medulloblastoma 1875 0.00207238816591606
interstitial lung disease 292 0.00501169850042674
Endometriosis 535 0.0146322841931228
ovarian cancer 8492 0.0446247250093291
Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 105 3.018 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
interstitial lung disease -1.200 0.005
osteosarcoma 1.626 0.001
juvenile dermatomyositis 1.143 0.000
primary pancreatic ductal adenocarcinoma 1.043 0.002
tuberculosis -3.300 0.000
diabetes mellitus -1.400 0.001
group 4 medulloblastoma 1.100 0.002
pilocytic astrocytoma 1.200 0.000
Endometriosis -1.460 0.015
ovarian cancer 1.100 0.045

Synonym

Accession Q8N128 Q68CT2
Symbols C14orf24

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Macaque EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
19663910 Remarkable repression of c14orf24 by miR124a was detected during neurogenesis.

AA Sequence

MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYS      1 - 70
TDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYY     71 - 140
RMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVS    141 - 210
VPP                                                                       211 - 213
//

Text Mined References (11)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19663910 2009 Noninvasive imaging of microRNA124a-mediated repression of the chromosome 14 ORF 24 gene during neurogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...