Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.37
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Uterine fibroid 29 3.035 1.5
Carcinoma 2,147 1.0

AA Sequence

MSYPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATSQEDVVPQAAENS      1 - 70
ELETEIQKDQREEDLKEELLLLQTPIPRKLVSHKPLNDRSRSHSGKVEMKANNFPINHKTRFRLSTSWRV     71 - 140
PFINSHEIRSMILHLLCDRYFSQAAGCQNTMWVKRKYIACLYHPNSFTHHERAITFRRPSRVHYYRPLTE    141 - 210
RMTSGKFCKSTDTKGKCRFRAIVRSVLFVSQIQIESIFNIKGFVDILTYIHTMNVMITNTNNGWKYFCPI    211 - 280
CGRLFNTYSELRQHSCSSSGN                                                     281 - 301
//

Text Mined References (6)

PMID Year Title
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11499681 2001 Physical and transcriptional mapping of the X-linked cleft palate and ankyloglossia (CPX) critical region.