Property Summary

NCBI Gene PubMed Count 91
Grant Count 276
R01 Count 182
Funding $17,941,836.23
PubMed Score 554.83
PubTator Score 117.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.014

Synonym

Accession Q8N122 B2RN36 C6KEF2 F5H7J5 Q8N4V9 Q8TB32 Q9P2P3 Raptor
Symbols KOG1
Mip1

Gene

Gene RIF (49)

PMID Text
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26363527 the expressions of Beclin1, Raptor, and Rictor are related to the development and progression of colorectal carcinoma and multidrug resistance.
25849663 microRNA-210 and raptor are involved in mithramycin-mediated erythroid differentiation of K562 cells and participate to the fine-tuning and control of gamma-globin gene expression in erythroid precursor cells.
25533680 Studied the impact of SNPs in/near UCP3 and RPTOR on obesity-related traits.
25249372 Common genetic variation in RPTOR is associated with overweight/obesity but does not discernibly contribute to either essential hypertension or isolated systolic hypertension in the Hawaiian population studied.
25053281 RPTOR was not associated with bipolar disorder or schizophrenia.
24516643 phosphorylating the T-loop Akt residue Thr(308) by PDK1 requires Raptor of the mTORC1 complex as a platform or scaffold protein.
24403073 peptides that encompass the Raptor cross-linking region of 4E-BP1 inhibit cross-linking and interaction of 4E-BP1 with Raptor.
24337580 Amino acids promote mTORC1 activation without altering Rag GTP charging.
24005976 suggest no connection of RPTOR variants with psoriasis or its subphenotypes.
More...

AA Sequence

MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGV      1 - 70
DPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRN     71 - 140
AKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFA    141 - 210
LQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCM    211 - 280
QKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF    281 - 350
LLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL    351 - 420
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPL    421 - 490
LVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIA    491 - 560
ICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNS    561 - 630
AERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATT    631 - 700
EGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLG    701 - 770
SPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK    771 - 840
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTG    841 - 910
PAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDL    911 - 980
ESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWD    981 - 1050
WEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLP   1051 - 1120
TTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSI   1121 - 1190
RVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD   1191 - 1260
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV   1261 - 1330
EKRVR                                                                    1331 - 1335
//

Text Mined References (105)

PMID Year Title
26787466 2016 The PtdIns3-phosphatase MTMR3 interacts with mTORC1 and suppresses its activity.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26363527 2015 Autophagy-related genes Raptor, Rictor, and Beclin1 expression and relationship with multidrug resistance in colorectal carcinoma.
25849663 2015 Increase of microRNA-210, decrease of raptor gene expression and alteration of mammalian target of rapamycin regulated proteins following mithramycin treatment of human erythroid cells.
25657994 The Potential Role of BRCA1-Associated ATM Activator-1 (BRAT1) in Regulation of mTOR.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25533680 2014 Seasonal effects of the UCP3 and the RPTOR gene polymorphisms on obesity traits in Japanese adults.
25446900 2014 Rab1A is an mTORC1 activator and a colorectal oncogene.
25249372 2015 Genetic variation in the raptor gene is associated with overweight but not hypertension in American men of Japanese ancestry.
25053281 2015 Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder.
More...