Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.94
PubTator Score 20.86

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (16)

PMID Text
26437028 Data show that MMP21 (encoding matrix metallopeptidase 21) point mutations were verified by Sanger sequencing, and segregation analysis indicated recessive inheritance.
26429889 loss of MMP21 as a cause of heterotaxy in humans with concomitant defects in Notch signaling.
25015395 Increased MMP-21 expression in esophageal squamous cell carcinoma is associated with progression and lymph node metastasis.
24700287 These results suggest that high MMP-21 expression in lymph node metastatic foci can be used to predict survival in OSCC patients with LNM
23275114 analysis proved MMP-21 to be an independent prognostic factor for overall survival of gastric cancer patients
21656525 MMP-21 expression is elevated in primary CRC and related to tumor invasion and metastasis. MMP-21 was also proved to be an independent prognostic factor for patients with stage II and stage III colorectal cancer.
19921252 MMP-21 was expressed by Merkel cell carcinoma cells in 13/43 cases and in eight samples by stromal neutrophils. None of the samples with MMP-21-expressing neutrophils had metastasized to the lymph nodes
19601983 MMP-21 does not associate with invasion of squamous cell cancer but may be involved in keratinocyte differentiation.
18768525 A nonsynchronous polymorphism in the MMP-21 promoter does not significantly confer susceptibility to hepatocellular carcinoma in a southern Chinese population.
18768525 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLAASIFRPTLLLCWLAAPWPTQPESLFHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWG      1 - 70
PSPEGPPETPKGAALAEAVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRA     71 - 140
RSRRSPRAPLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSEVTP    141 - 210
LDFREDLAAPGAAVDIKLGFGRGRHLGCPRAFDGSGQEFAHAWRLGDIHFDDDEHFTPPTSDTGISLLKV    211 - 280
AVHEIGHVLGLPHTYRTGSIMQPNYIPQEPAFELDWSDRKAIQKLYGSCEGSFDTAFDWIRKERNQYGEV    281 - 350
MVRFSTYFFRNSWYWLYENRNNRTRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYD    351 - 420
SDKDQALTEDEQGKSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRIT    421 - 490
EVFPAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFISEKWFDVC    491 - 560
DVHISTLNM                                                                 561 - 569
//

Text Mined References (22)

PMID Year Title
26437028 2015 MMP21 is mutated in human heterotaxy and is required for normal left-right asymmetry in vertebrates.
26429889 2015 A human laterality disorder caused by a homozygous deleterious mutation in MMP21.
25015395 2014 Increased MMP-21 expression in esophageal squamous cell carcinoma is associated with progression and prognosis.
24700287 2014 High MMP-21 expression in metastatic lymph nodes predicts unfavorable overall survival for oral squamous cell carcinoma patients with lymphatic metastasis.
23275114 2013 Increased MMP-21 expression is associated with poor overall survival of patients with gastric cancer.
21656525 2011 Identification of high-risk stage II and stage III colorectal cancer by analysis of MMP-21 expression.
21590459 2011 Overexpression of matrix metalloproteinase-21 is associated with poor overall survival of patients with colorectal cancer.
21067565 2010 Comparative expression pattern of Matrix-Metalloproteinases in human glioblastoma cell-lines and primary cultures.
19921252 2009 Expression of MMP-10, MMP-21, MMP-26, and MMP-28 in Merkel cell carcinoma.
19601983 2009 MMP-10 (Stromelysin-2) and MMP-21 in human and murine squamous cell cancer.
More...