Property Summary

NCBI Gene PubMed Count 8
Grant Count 7
Funding $599,937.7
PubMed Score 7.10
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -3.400 0.002
ependymoma -4.200 0.000
oligodendroglioma -3.100 0.007
glioblastoma -4.400 0.000
medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -4.700 0.000
primitive neuroectodermal tumor -3.000 0.000
fascioscapulohumeral muscular dystrophy 1.097 0.000
intraductal papillary-mucinous carcinoma... -1.900 0.009
active Crohn's disease 3.760 0.001
active ulcerative colitis 2.906 0.003
lung adenocarcinoma -1.900 0.000
adult high grade glioma -4.300 0.000
pilocytic astrocytoma -4.000 0.000
lung carcinoma -2.300 0.000
Breast cancer -1.500 0.048
ovarian cancer -2.100 0.001

Gene RIF (2)

PMID Text
25595103 Key residues were identified to be responsible for the binding of arachidonic acid and anandamide with orphan human cytochrome P450 4X1.
15797250 PPARalpha has a role in CYP4X1 regulation, and the glucocorticoid and progesterone receptors have roles in CYP4Z1 gene activation

AA Sequence

MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLE      1 - 70
EIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLL     71 - 140
TPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHD    141 - 210
PYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPK    211 - 280
RKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGIL    281 - 350
GDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW    351 - 420
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNH    421 - 490
FILKPKNGMYLHLKKLSEC                                                       491 - 509
//

Text Mined References (10)

PMID Year Title
25595103 2015 Computational identification and binding analysis of orphan human cytochrome P450 4X1 enzyme with substrates.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16478468 2006 Cytochrome P450 Cyp4x1 is a major P450 protein in mouse brain.
15797250 2005 Conditional regulation of the human CYP4X1 and CYP4Z1 genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176035 2002 Identification of a novel cytochrome P450, CYP4X1, with unique localization specific to the brain.