Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.20
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease 3.760 1.4e-03
active ulcerative colitis 2.906 3.1e-03
adult high grade glioma -4.300 1.5e-08
astrocytic glioma -3.400 1.8e-03
Astrocytoma, Pilocytic -4.000 3.5e-12
atypical teratoid / rhabdoid tumor -4.100 2.7e-09
Breast cancer -1.500 4.8e-02
ependymoma -4.000 1.4e-03
fascioscapulohumeral muscular dystrophy 1.097 2.2e-04
glioblastoma -3.500 2.5e-09
group 3 medulloblastoma -3.200 4.8e-04
intraductal papillary-mucinous carcinoma... -1.900 9.2e-03
lung adenocarcinoma -1.900 5.3e-13
lung carcinoma -2.300 9.9e-18
medulloblastoma, large-cell -4.700 6.4e-07
oligodendroglioma -3.100 7.4e-03
ovarian cancer -2.100 9.5e-04
primitive neuroectodermal tumor -3.000 1.7e-04

Gene RIF (2)

AA Sequence

MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLE      1 - 70
EIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLL     71 - 140
TPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHD    141 - 210
PYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPK    211 - 280
RKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGIL    281 - 350
GDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW    351 - 420
KNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNH    421 - 490
FILKPKNGMYLHLKKLSEC                                                       491 - 509
//

Text Mined References (10)

PMID Year Title