Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.87
PubTator Score 2.60

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.65324780943395E-12
tuberculosis 1563 1.6484892947389E-6
ovarian cancer 8492 4.98954521989308E-6
osteosarcoma 7933 2.2713854084419E-5
primary pancreatic ductal adenocarcinoma 1271 0.0019788049052245


  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.150 0.000
juvenile dermatomyositis 1.407 0.000
primary pancreatic ductal adenocarcinoma 1.100 0.002
tuberculosis 1.200 0.000
ovarian cancer 1.900 0.000


Accession Q8N114 B3KW99 F8W9N8 Q69YY9 Q7Z433 Q8NHL9 Q96MW8 Q9BV58
Symbols SCOTIN


PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid

 MGI Term (1)

Gene RIF (4)

26868272 IFN-beta-induced SCOTIN recruits the HCV NS5A protein to autophagosomes for degradation, thereby restricting HCV replication.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17889823 ALG-2 binding to Scotin is strictly calcium dependent, indicating a role of this interaction in calcium signaling pathways
12135983 Scotin plays a role in p53-dependent apoptosis

AA Sequence

ETLAGGAAAPYPASQPPYNPAYMDAPKAAL                                            211 - 240

Text Mined References (15)

PMID Year Title
26868272 2016 Interferon-inducible protein SCOTIN interferes with HCV replication through the autolysosomal degradation of NS5A.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17889823 2007 The calcium binding protein ALG-2 binds and stabilizes Scotin, a p53-inducible gene product localized at the endoplasmic reticulum membrane.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15064722 2004 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.