Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.93
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.407 1.7e-12
osteosarcoma -2.150 2.3e-05
ovarian cancer 1.900 5.0e-06
primary pancreatic ductal adenocarcinoma 1.100 2.0e-03
tuberculosis 1.200 1.6e-06

Gene RIF (4)

AA Sequence

MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEE      1 - 70
RCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCR     71 - 140
RPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYH    141 - 210
ETLAGGAAAPYPASQPPYNPAYMDAPKAAL                                            211 - 240
//

Text Mined References (15)

PMID Year Title