Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.73
PubTator Score 7.83

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
18499894 BM88/Cend1 participates in cell cycle control and neuronal differentiation mechanisms during neonatal SVZ neurogenesis and becomes crucial for the transition from neuroblasts to mature neurons when reaching high levels

AA Sequence

MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQPPAAPTTAPAKKTSAKADPA      1 - 70
LLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALIL     71 - 140
GVAFLVRKK                                                                 141 - 149
//

Text Mined References (8)

PMID Year Title
18499894 2008 BM88/Cend1 expression levels are critical for proliferation and differentiation of subventricular zone-derived neural precursor cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16181419 2005 Characterization of the BM88 promoter and identification of an 88 bp fragment sufficient to drive neurone-specific expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11311134 2001 Cloning, expression and localization of human BM88 shows that it maps to chromosome 11p15.5, a region implicated in Beckwith-Wiedemann syndrome and tumorigenesis.