Property Summary

NCBI Gene PubMed Count 94
PubMed Score 0.00
PubTator Score 30.21

Knowledge Summary

Patent

No data available

Gene RIF (89)

PMID Text
25253288 Data show that KIR2DL5 receptor, KIR2DS1 protein, KIR2DS5 protein and KIR3DS1 receptors were all significantly associated with high viral load.
24929143 The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases.
23234877 A significant upregulation of KIR2DL5A occurs in Alzheimer's disease fast progessors compared to slow progressors.
22652695 indicate that killer-cell immunoglobulin-like receptors (KIRs)activator (KIR3DS1 and KIR2DS5) and inhibitory (KIR2DL5) genes are associated with severe pandemic influenza A (H1N1) 2009 infections.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20643584 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPE      1 - 70
LYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENV     71 - 140
TLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDP    141 - 210
LLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGD    211 - 280
RTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQAL    281 - 350
RGSSRETTALSQNRVASSHVPAAGI                                                 351 - 375
//

Text Mined References (95)

PMID Year Title
25253288 2014 Killer immunoglobulin-like receptor gene repertoire influences viral load of primary human cytomegalovirus infection in renal transplant patients.
24929143 2014 Killer-cell immunoglobulin-like receptors and falciparum malaria in southwest Nigeria.
23394822 2013 Recombinant structures expand and contract inter and intragenic diversification at the KIR locus.
23234877 2013 Gene expression profiling of peripheral blood leukocytes shows consistent longitudinal downregulation of TOMM40 and upregulation of KIR2DL5A, PLOD1, and SLC2A8 among fast progressors in early Alzheimer's disease.
22652695 2012 Killer-cell immunoglobulin-like receptors (KIR) in severe A (H1N1) 2009 influenza infections.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
More...