Property Summary

NCBI Gene PubMed Count 9
PubMed Score 15.51
PubTator Score 5.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dyskinesia of esophagus 10 3.217 1.6

Gene RIF (1)

AA Sequence

MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID           1 - 65
//

Text Mined References (11)

PMID Year Title