Property Summary

NCBI Gene PubMed Count 8
PubMed Score 24.02
PubTator Score 5.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
limb-girdle muscular dystrophy 36 3.122 1.6

Gene RIF (1)

PMID Text
24189797 DEFB106 (also known as DEFB6) displays antimicrobial activity against E. coli, C. albicans and S. aureus.

AA Sequence

MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIID           1 - 65
//

Text Mined References (10)

PMID Year Title
24189797 2014 Soluble fusion expression, characterization and localization of human ?-defensin 6.
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15727258 2004 Evidence for duplication of the human defensin gene DEFB4 in chromosomal region 8p22-23 and implications for the analysis of SNP allele distribution.
15588320 2004 Polymorphic segmental duplications at 8p23.1 challenge the determination of individual defensin gene repertoires and the assembly of a contiguous human reference sequence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12916016 2003 Extensive normal copy number variation of a beta-defensin antimicrobial-gene cluster.
12734011 2003 Duplication and selection in the evolution of primate beta-defensin genes.
12600824 2003 ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.
12193721 2002 Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.
11854508 2002 Discovery of five conserved beta -defensin gene clusters using a computational search strategy.