Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.08
PubTator Score 17.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.100 0.012
osteosarcoma -3.264 0.000
glioblastoma 1.500 0.001
periodontitis 1.700 0.000
non-small cell lung cancer -1.361 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.013
sarcoidosis 1.400 0.046
interstitial cystitis 1.600 0.000
adult high grade glioma 1.700 0.002
pilocytic astrocytoma 2.200 0.000
primary Sjogren syndrome 2.800 0.000
subependymal giant cell astrocytoma 1.782 0.050
invasive ductal carcinoma 1.721 0.006
lung carcinoma -1.500 0.000
ulcerative colitis 4.400 0.000
ovarian cancer -3.000 0.000

Gene RIF (16)

PMID Text
25197941 SNPs in TAGAP are associated with increased risk of candidemia.
24582067 Colonic expression of TAGAP in Crohn's disease varies according to disease severity and location, being the most elevated in patients with severe disease in the sigmoid colon
23898208 HIV-1 Tat downregulates the expression of T-cell activation RhoGTPase activating protein (TAGAP) in human primary T cells
23453471 we suggest that polymorphism rs212389 better predicts the association of TAGAP locus with RA.
23044675 Rs212388 single nucleotide polymorphism most significantly correlated with the presence and severity of anal disease in ileocolonic Crohn's disease.
22127930 SNPs in regulatory regions of TAGAP and an intronic SNP (TNFAIP3) are potential susceptibility loci in African Americans.
21390051 study has refined the TAGAP signal of association to a single haplotype in rheumatoid arthritis (RA), and in doing so provides conclusive statistical evidence that the TAGAP locus is associated with RA risk
20854658 there is strong evidence that variation within the TAGAP gene is associated with rheumatoid arthritis, type 1 diabetes and coeliac disease
20854658 Observational study of gene-disease association. (HuGE Navigator)
20647273 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSWPFLMRRLSPA      1 - 70
SDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEGIFRRAANEKARKELKEELNS     71 - 140
GDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMGALEMQDEEDRIEALKQVADKLPRPNLLLLK    141 - 210
HLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGEN    211 - 280
IPVHSSITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDA    281 - 350
REVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED    351 - 420
PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSPKRNFFSRHQS    421 - 490
FTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGSGKSQDFTRDHVPRGVRKESQLAGRIVQENGCE    491 - 560
THNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAMQGPAARLVASESQTVGSMTVGSMRARMLEA    561 - 630
HCLLPPLPPAHHVEDSRHRGSKEPLPGHGLSPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSES    631 - 700
VQRNKRDCLVRRCSQPVFEADQFQYAKESYI                                           701 - 731
//

Text Mined References (33)

PMID Year Title
25197941 2014 Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24582067 2014 T-cell activation Rho GTPase-activating protein expression varies with inflammation location and severity in Crohn's disease.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453471 2013 Validation of the TAGAP rs212389 polymorphism in rheumatoid arthritis susceptibility.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23044675 2012 Mutation in TAGAP is protective of anal sepsis in ileocolic Crohn's disease.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
More...