Property Summary

NCBI Gene PubMed Count 26
PubMed Score 1060.59
PubTator Score 26.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 9.5e-03
Astrocytoma, Pilocytic -1.100 5.2e-06
atypical teratoid / rhabdoid tumor -1.200 1.6e-06
ependymoma -1.800 1.7e-02
glioblastoma -1.100 1.0e-05
group 3 medulloblastoma 1.900 6.1e-03
oligodendroglioma -1.600 1.3e-02

 GO Component (1)

Gene RIF (19)

AA Sequence

MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQW      1 - 70
GQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRL     71 - 140
FGFQPEPFQMAT                                                              141 - 152
//

Text Mined References (27)

PMID Year Title