Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.06775820691258E-20
atypical teratoid / rhabdoid tumor 4369 1.09218443142977E-7
osteosarcoma 7933 1.29093042369588E-7
ovarian cancer 8492 8.45875925098977E-7
Pick disease 1893 1.30990429686891E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.06110529745641E-4
ulcerative colitis 2087 1.24191154833155E-4
interstitial cystitis 2299 1.33390306464385E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.64108994374188E-4
medulloblastoma, large-cell 6234 0.00160430920717523
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00261229435504433
spina bifida 1064 0.035817889435841
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0456598923025856

Expression

 GWAS Trait (1)

AA Sequence

MAAGGSAPEPRVLVCLGALLAGWVAVGLEAVVIGEVHENVTLHCGNISGLRGQVTWYRNNSEPVFLLSSN      1 - 70
SSLRPAEPRFSLVDATSLHIESLSLGDEGIYTCQEILNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGT     71 - 140
LYAARGSQVDFSCNSSSRPPPVVEWWFQALNSSSESFGHNLTVNFFSLLLISPNLQGNYTCLALNQLSKR    141 - 210
HRKVTTELLVYYPPPSAPQCWAQMASGSFMLQLTCRWDGGYPDPDFLWIEEPGGVIVGKSKLGVEMLSES    211 - 280
QLSDGKKFKCVTSHIVGPESGASCMVQIRGPSLLSEPMKTCFTGGNVTLTCQVSGAYPPAKILWLRNLTQ    281 - 350
PEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVKEPLNIGGIVGTIVS    351 - 420
LLLLGLAIISGLLLHYSPVFCWKVGNTSRGQNMDDVMVLVDSEEEEEEEEEEEEDAAVGEQEGAREREEL    421 - 490
PKEIPKQDHIHRVTALVNGNIEQMGNGFQDLQDDSSEEQSDIVQEEDRPV                        491 - 540
//

Text Mined References (6)

PMID Year Title
24909733 2014 TAOK3, a novel genome-wide association study locus associated with morphine requirement and postoperative pain in a retrospective pediatric day surgery population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.