Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.200 4.1e-03
lung adenocarcinoma 1.300 2.4e-11
non primary Sjogren syndrome sicca 1.200 2.5e-02

AA Sequence

MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVH      1 - 70
ALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHR     71 - 140
RDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVT    141 - 210
PEESRKLRFWNLEFESQSFLYRQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLK    211 - 280
SVLYGNLGAASCTLQGPQFGSHG                                                   281 - 303
//

Text Mined References (8)

PMID Year Title