Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.66
PubTator Score 4.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Breast cancer 3,094

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.200 0.000

Synonym

Accession Q8N0Z6 A8MQ18 Q96HF9 TPR repeat protein 5
Symbols Strap

Gene

PDB

2XVS  

Gene RIF (3)

PMID Text
24091941 Human TTC5, a novel tetratricopeptide repeat domain containing gene, activates p53 and inhibits AP-1 pathway.
23559008 TTC5 and EP300 cooperate to prevent excessive accumulation of MYC in AML cells and their sensitization to cell death.
21147850 TTC5 is a novel cofactor regulating GR function in a stress-dependent manner.

AA Sequence

MMADEEEEVKPILQKLQELVDQLYSFRDCYFETHSVEDAGRKQQDVQKEMEKTLQQMEEVVGSVQGKAQV      1 - 70
LMLTGKALNVTPDYSPKAEELLSKAVKLEPELVEAWNQLGEVYWKKGDVAAAHTCFSGALTHCRNKVSLQ     71 - 140
NLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGRSWYILGNSYLSLYFSTGQNPKISQQALSAY    141 - 210
AQAEKVDRKASSNPDLHLNRATLHKYEESYGEALEGFSRAAALDPAWPEPRQREQQLLEFLDRLTSLLES    211 - 280
KGKVKTKKLQSMLGSLRPAHLGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEK    281 - 350
VPFTFGLVDSDGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNG    351 - 420
KPQGSSSQAVATVASRPQCE                                                      421 - 440
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24091941 2013 Human TTC5, a novel tetratricopeptide repeat domain containing gene, activates p53 and inhibits AP-1 pathway.
23559008 2013 TTC5 is required to prevent apoptosis of acute myeloid leukemia stem cells.
22362889 2012 The p53 cofactor Strap exhibits an unexpected TPR motif and oligonucleotide-binding (OB)-fold structure.
21269460 2011 Initial characterization of the human central proteome.
21147850 2011 Regulation of glucocorticoid receptor activity by a stress responsive transcriptional cofactor.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...