Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.47
PubTator Score 10.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Menkes disease 19 3.512 1.8

Expression

Synonym

Accession Q8N0Y7 Q5JPN2 Q8NI24 Q8NI25 Q8NI26
Symbols PGAM1
PGAM3
PGAM-B
dJ1000K24.1

Gene

  Ortholog (1)

Species Source Disease
Xenopus OMA Inparanoid

Gene RIF (2)

AA Sequence

MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTV      1 - 70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR     71 - 140
RYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNL    141 - 210
PTGIPIVYELDKNLKPIKPMQFLGDEETVCKAIEAVAAQGKAKK                              211 - 254
//

Text Mined References (9)

PMID Year Title