Property Summary

NCBI Gene PubMed Count 8
PubMed Score 14.30
PubTator Score 10.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Menkes disease 20 3.562 1.8

Expression

Synonym

Accession Q8N0Y7 Q5JPN2 Q8NI24 Q8NI25 Q8NI26
Symbols PGAM1
PGAM3
PGAM-B
dJ1000K24.1

Gene

Gene RIF (2)

PMID Text
23631659 PGAM4 coding region mutations were not observed and the G75C polymorphism is not associated with non-obstructive azoospermia susceptibility among the Chinese Han population.
22590500 PGAM4, an X-linked retrogene, is a fundamental gene in human male reproduction and may escape meiotic sex chromosome inactivation.

AA Sequence

MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTV      1 - 70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR     71 - 140
RYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNL    141 - 210
PTGIPIVYELDKNLKPIKPMQFLGDEETVCKAIEAVAAQGKAKK                              211 - 254
//

Text Mined References (9)

PMID Year Title
23631659 2013 The PGAM4 gene in non-obstructive azoospermia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22590500 2012 A single nucleotide polymorphism within the novel sex-linked testis-specific retrotransposed PGAM4 gene influences human male fertility.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
15772651 2005 The DNA sequence of the human X chromosome.
11961099 2002 Evolution of the phosphoglycerate mutase processed gene in human and chimpanzee revealing the origin of a new primate gene.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9370262 1997 A phosphoglycerate mutase brain isoform (PGAM 1) pseudogene is localized within the human Menkes disease gene (ATP7 A).