Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.88
PubTator Score 0.70

Knowledge Summary

Patent (249)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Prader-Willi syndrome 48 3.378 1.7

AA Sequence

MKIANNTVVTEFILLGLTQSQDIQLLVFVLILIFYLIILPGNFLIIFTIRSDPGLTAPLYLFLGNLAFLD      1 - 70
ASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAFDRYIAICRPLHCSTVMNPRA     71 - 140
CYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCDVRQVIKLACTDMFVVELLMVFNSGLMTLLC    141 - 210
FLGLLASYAVILCHVRRAASEGKNKAMSTCTTRVIIILLMFGPAIFIYMCPFRALPADKMVSLFHTVIFP    211 - 280
LMNPMIYTLRNQEVKTSMKRLLSRHVVCQVDFIIRN                                      281 - 316
//

Text Mined References (4)

PMID Year Title