Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.39
PubTator Score 3.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.100 3.0e-02
malignant mesothelioma 1.100 1.1e-05
osteosarcoma -1.562 1.3e-06
psoriasis -1.100 4.7e-04

Gene RIF (2)

AA Sequence

MEVAVPVKQEAEGLALDSPWHRFRRFHLGDAPGPREALGLLRALCRDWLRPEVHTKEQMLELLVLEQFLS      1 - 70
ALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMIPLAGTAP     71 - 140
GAEGPAPGDSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGEKPHACP    141 - 210
ECGKAFRRKEHLRRHRDTHPGSPGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFAC    211 - 280
WECGKGFGRREHVLRHQRIHGRAAASAQGAVAPGPDGGGPFPPWPLG                           281 - 327
//

Text Mined References (12)

PMID Year Title