Property Summary

NCBI Gene PubMed Count 35
PubMed Score 52.75
PubTator Score 29.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Paraplegia 74 5.804 2.9
Disease Target Count
Troyer syndrome 5

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.150 5.9e-03
adrenocortical carcinoma -1.677 1.8e-04
Breast cancer -1.100 4.6e-04
ductal carcinoma in situ -1.100 3.3e-03
ependymoma 1.200 1.3e-05
intraductal papillary-mucinous adenoma (... -1.300 1.6e-02
intraductal papillary-mucinous carcinoma... -2.200 2.1e-03
intraductal papillary-mucinous neoplasm ... -2.500 2.4e-02
invasive ductal carcinoma -1.700 2.3e-04
lung cancer -2.300 2.1e-04
lung carcinoma -1.400 1.2e-30
non-small cell lung cancer -1.124 3.4e-19
ovarian cancer -2.000 3.4e-04
ulcerative colitis 1.600 4.8e-05

Protein-protein Interaction (5)

Gene RIF (19)

AA Sequence

MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPG      1 - 70
WESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAE     71 - 140
VNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPP    141 - 210
LETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVP    211 - 280
DRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI    281 - 350
PGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELPEWS    351 - 420
EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKV    421 - 490
SQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAA    491 - 560
KCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQI    561 - 630
VDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK                                      631 - 666
//

Text Mined References (42)

PMID Year Title