Property Summary

NCBI Gene PubMed Count 12
PubMed Score 32.46
PubTator Score 143.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
group 4 medulloblastoma 1875 2.69718801110024E-8
Breast cancer 3099 5.6318505364165E-8
tuberculosis 1563 3.08757511111098E-7
ulcerative colitis 2087 1.06928971583429E-5
osteosarcoma 7933 3.18126588249719E-5
pituitary cancer 1972 4.61120765484338E-5
glioblastoma 5572 1.75018733697305E-4
adrenocortical carcinoma 1427 2.09775430835258E-4
primitive neuroectodermal tumor 3031 0.00593342746928496
astrocytic glioma 2241 0.0073452253913514
urothelial carcinoma 318 0.0449935177106663

Expression

  Differential Expression (11)

Disease log2 FC p
urothelial carcinoma -1.200 0.045
astrocytic glioma -1.600 0.007
osteosarcoma -1.923 0.000
glioblastoma -1.100 0.000
group 4 medulloblastoma -1.900 0.000
primitive neuroectodermal tumor -1.200 0.006
adrenocortical carcinoma -1.364 0.000
tuberculosis 1.600 0.000
Breast cancer -1.300 0.000
ulcerative colitis -1.700 0.000
pituitary cancer 1.300 0.000

Synonym

Gene

  Ortholog (15)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCA      1 - 70
VLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVES     71 - 140
PEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRAS    141 - 210
IGATSSKETLDILYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVV    211 - 280
QEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK              281 - 340
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
24334609 2014 CLYBL is a polymorphic human enzyme with malate synthase and ?-methylmalate synthase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...