Property Summary

NCBI Gene PubMed Count 12
Grant Count 15
R01 Count 11
Funding $2,197,705.33
PubMed Score 32.46
PubTator Score 143.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
urothelial carcinoma -1.200 0.045
astrocytic glioma -1.600 0.007
osteosarcoma -1.923 0.000
glioblastoma -1.100 0.000
group 4 medulloblastoma -1.900 0.000
primitive neuroectodermal tumor -1.200 0.006
adrenocortical carcinoma -1.364 0.000
tuberculosis 1.600 0.000
Breast cancer -1.300 0.000
ulcerative colitis -1.700 0.000
pituitary cancer 1.300 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCA      1 - 70
VLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVES     71 - 140
PEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRAS    141 - 210
IGATSSKETLDILYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVV    211 - 280
QEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK              281 - 340
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24532677 2015 A genome-wide association study of rheumatoid arthritis without antibodies against citrullinated peptides.
24334609 2014 CLYBL is a polymorphic human enzyme with malate synthase and ?-methylmalate synthase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...