Property Summary

NCBI Gene PubMed Count 13
PubMed Score 34.38
PubTator Score 143.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.364 2.1e-04
astrocytic glioma -1.600 7.3e-03
Breast cancer -1.300 5.6e-08
glioblastoma -1.100 1.8e-04
group 3 medulloblastoma -1.200 2.2e-03
osteosarcoma -1.923 3.2e-05
pituitary cancer 1.300 4.6e-05
primitive neuroectodermal tumor -1.200 5.9e-03
tuberculosis 1.600 3.1e-07
ulcerative colitis -1.700 1.1e-05
urothelial carcinoma -1.200 4.5e-02

Gene RIF (3)

AA Sequence

MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCA      1 - 70
VLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVES     71 - 140
PEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRAS    141 - 210
IGATSSKETLDILYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVV    211 - 280
QEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK              281 - 340
//

Text Mined References (18)

PMID Year Title