Property Summary

NCBI Gene PubMed Count 15
Grant Count 14
R01 Count 11
Funding $805,967.83
PubMed Score 24.17
PubTator Score 21.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis -1.200 0.000
cutaneous lupus erythematosus -1.400 0.000
posterior fossa group B ependymoma 1.900 0.000
medulloblastoma, large-cell -1.500 0.000
lung cancer 1.400 0.001
interstitial cystitis -2.100 0.000
nasopharyngeal carcinoma -1.100 0.008
Breast cancer -1.500 0.001
ovarian cancer -1.500 0.003
chronic rhinosinusitis -1.584 0.017
cystic fibrosis and chronic rhinosinusit... -1.284 0.030

Gene RIF (8)

PMID Text
25086173 SPAG16 is a novel autoantibody target in a subgroup of MS patients and in combination with other diagnostic criteria, elevated levels of anti-SPAG16 Abs could be used as a biomarker for diagnosis.
23956247 SPAG16 influences MMP-3 regulation and protects against joint destruction in autoantibody-positive rheumatoid arthritis.
22963137 Analysis of SPAG16 regions encoding conserved WD repeats revealed no evidence for association of mutations or genetic variation with sperm motility in infertile males.
22082156 Knockdown of sperm associated antigen 16 (SPAG16) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20463177 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17699735 Heterozygous mutation that affects both SPAG16L and SPAG16S does not cause male infertility in man, but is associated with reduced stability of the interacting proteins of the central apparatus.
12391165 Data describe the cloning of human and mouse Pf20 proteins that interact with Spag6 protein.

AA Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIP      1 - 70
EGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKG     71 - 140
VTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLI    141 - 210
NDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQRGHSYHGPQIKVDH    211 - 280
SREKENAPEGPTQKGLREAREQNKCKTKMKGNTKDSEFPIDMQPNPNLNVSKESLSPAKFDYKLKNIFRL    281 - 350
HELPVSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSGDKLATSSGDTTVKL    351 - 420
WDLCKGDCILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDSVNSIEFFPFS    421 - 490
NTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKLLPIVSIDI    491 - 560
GPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW    561 - 630
S//

Text Mined References (16)

PMID Year Title
25086173 2014 Sperm-associated antigen 16 is a novel target of the humoral autoimmune response in multiple sclerosis.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
23956247 2014 Identification of a genetic variant for joint damage progression in autoantibody-positive rheumatoid arthritis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22963137 2012 Genetic variation in SPAG16 regions encoding the WD40 repeats is not associated with reduced sperm motility and axonemal defects in a population of infertile males.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17699735 2007 A heterozygous mutation disrupting the SPAG16 gene results in biochemical instability of central apparatus components of the human sperm axoneme.
More...