Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.29
PubTator Score 21.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.500 1.2e-03
chronic rhinosinusitis -1.584 1.7e-02
cutaneous lupus erythematosus -1.400 7.1e-05
cystic fibrosis and chronic rhinosinusit... -1.284 3.0e-02
ependymoma 1.600 6.3e-13
interstitial cystitis -2.000 9.7e-04
lung cancer 1.400 1.0e-03
malignant mesothelioma -2.100 1.7e-07
medulloblastoma, large-cell -1.400 3.9e-02
nasopharyngeal carcinoma -1.100 7.9e-03
ovarian cancer -1.500 3.5e-03
psoriasis -1.200 1.4e-06

Gene RIF (9)

AA Sequence

MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIP      1 - 70
EGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKG     71 - 140
VTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLI    141 - 210
NDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVGQISGLQETLKKLQRGHSYHGPQIKVDH    211 - 280
SREKENAPEGPTQKGLREAREQNKCKTKMKGNTKDSEFPIDMQPNPNLNVSKESLSPAKFDYKLKNIFRL    281 - 350
HELPVSCVSMQPHKDILVSCGEDRLWKVLGLPKCNVLLTGFGHTDWLSDCCFHPSGDKLATSSGDTTVKL    351 - 420
WDLCKGDCILTFEGHSRAVWSCTWHSCGNFVASSSLDKTSKIWDVNSERCRCTLYGHTDSVNSIEFFPFS    421 - 490
NTLLTSSADKTLSIWDARTGICEQSLYGHMHSINDAIFDPRGHMIASCDACGVTKLWDFRKLLPIVSIDI    491 - 560
GPSPGNEVNFDSSGRVLAQASGNGVIHLLDLKSGEIHKLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW    561 - 630
S//

Text Mined References (17)

PMID Year Title