Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.18
PubTator Score 3.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
26648093 NY-SAR35 was predominantly expressed at the cytoplasm.
21318630 The analysis of methylation status of the NY-SAR-35 gene promoter in various cancer cell lines showed that its expression was related to methylation of the promoter region.

AA Sequence

MSSHRRKAKGRNRRSHRAMRVAHLELATYELAATESNPESSHPGYEAAMADRPQPGWRESLKMRVSKPFG      1 - 70
MLMLSIWILLFVCYYLSYYLCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQ     71 - 140
VAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQMMQMFGLGAISLILVCLPIYCRSLFWR    141 - 210
SEPADDLQRQDNRVVTGLKKQRRKRKRKSEMLQKAARGREEHGDE                             211 - 255
//

Text Mined References (9)

PMID Year Title
26648093 2016 Cancer/testis antigen NY-SAR-35 enhances cell proliferation, migration, and invasion.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
21318630 2011 Expression of the human cancer/testis antigen NY-SAR-35 is activated by CpG island hypomethylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12601173 2003 Immunomic analysis of human sarcoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.