Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.35
PubTator Score 1.19

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.6e-04
Breast cancer -1.100 2.3e-03
chronic rhinosinusitis -1.076 3.7e-02
Down syndrome 1.300 8.3e-04
ependymoma 1.500 5.5e-13
esophageal adenocarcinoma 1.100 1.9e-02
lung cancer -1.200 3.8e-03
malignant mesothelioma -2.000 5.0e-07
osteosarcoma 1.611 4.2e-05

Gene RIF (2)

AA Sequence

MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICKEYEAEQPPFP      1 - 70
EGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSETINPKTCSPKEYLETFIFPVL     71 - 140
LPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLS    141 - 210
LLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAA    211 - 280
KMKIPSS                                                                   281 - 287
//

Text Mined References (11)

PMID Year Title