Property Summary

NCBI Gene PubMed Count 49
Grant Count 19
R01 Count 10
Funding $3,002,703.09
PubMed Score 50.63
PubTator Score 41.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
25675530 Endogenous NLGN4X is intensely phosphorylated on T707 upon PKC stimulation in human neurons.
24570023 Our data provided a further evidence for the involvement of NLGN3 and NLGN4X gene in the pathogenesis of autism in Chinese population.
23851596 The present study explores, for the first time, the contribution of NLGN3 and NLGN4X genetic variants in Greek patients with autistic disorder.
23710042 In vitro models show NLGN4X knockdown directly impacts neurodevelopmental process during the formation of neurons and their connections.
23468870 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
23431752 Neuroligins are adhesion proteins that bind to beta-neurexin to form functional synapses.
22948383 Five genes have been directly disrupted in Tourette Syndrome by independent genomic rearrangements and copy number variations with unique breakpoints.
21278334 The autism-associated DeltaE4 mutation in NLGN4 compromises the ability of NLGN4 to localize correctly to the cell surface when overexpressed and to induce synaptic differentiation.
20714171 results indicate that the genetic variants located in NLGN4 can affect the cognitive abilities of boys.
20714171 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRTPLPNEILGPV      1 - 70
EQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQ     71 - 140
DQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGF    141 - 210
LSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS    211 - 280
GTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP    281 - 350
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI    351 - 420
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHG    421 - 490
DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWS    491 - 560
KYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPA    561 - 630
KIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK    631 - 700
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDD    701 - 770
IPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV                            771 - 816
//

Text Mined References (50)

PMID Year Title
25675530 2015 Autism-associated mutation inhibits protein kinase C-mediated neuroligin-4X enhancement of excitatory synapses.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24570023 2014 Variations analysis of NLGN3 and NLGN4X gene in Chinese autism patients.
23851596 2013 Mutation screening in the Greek population and evaluation of NLGN3 and NLGN4X genes causal factors for autism.
23710042 2013 The functional genetic link of NLGN4X knockdown and neurodevelopment in neural stem cells.
23468870 2013 Lack of association between NLGN3, NLGN4, SHANK2 and SHANK3 gene variants and autism spectrum disorder in a Chinese population.
23431752 2012 Analysis of the genes encoding neuroligins NLGN3 and NLGN4 in Bulgarian patients with autism.
22948383 2012 Pathogenetic model for Tourette syndrome delineates overlap with related neurodevelopmental disorders including Autism.
21278334 2011 Investigating synapse formation and function using human pluripotent stem cell-derived neurons.
20714171 2010 Gender differences in cognitive ability associated with genetic variants of NLGN4.
More...