Property Summary

NCBI Gene PubMed Count 52
PubMed Score 57.81
PubTator Score 41.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.500 1.8e-02
Breast cancer -3.400 2.2e-10
chronic kidney disease 1.100 4.5e-02
colon cancer -2.000 1.5e-05
ependymoma -1.200 5.1e-04
intraductal papillary-mucinous adenoma (... -1.200 3.6e-02
intraductal papillary-mucinous carcinoma... -1.600 7.4e-03
intraductal papillary-mucinous neoplasm ... -1.700 3.6e-02
medulloblastoma -1.100 1.5e-02
medulloblastoma, large-cell -2.800 6.0e-06
ovarian cancer -3.800 3.2e-08

Gene RIF (36)

AA Sequence

MSRPQGLLWLPLLFTPVCVMLNSNVLLWLTALAIKFTLIDSQAQYPVVNTNYGKIRGLRTPLPNEILGPV      1 - 70
EQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQ     71 - 140
DQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGF    141 - 210
LSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS    211 - 280
GTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVIP    281 - 350
DDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETI    351 - 420
KFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHG    421 - 490
DEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWS    491 - 560
KYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPA    561 - 630
KIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYKK    631 - 700
DKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDD    701 - 770
IPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV                            771 - 816
//

Text Mined References (53)

PMID Year Title