Property Summary

NCBI Gene PubMed Count 27
PubMed Score 71.63
PubTator Score 35.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease -1.491 3.3e-02
active ulcerative colitis -1.937 1.4e-02
acute myeloid leukemia -1.400 1.8e-02
Astrocytoma, Pilocytic 1.400 3.0e-03
atypical teratoid / rhabdoid tumor 1.500 3.3e-03
Breast cancer -1.100 1.3e-02
colon cancer -1.200 4.5e-02
cystic fibrosis 1.864 9.5e-05
lung cancer -1.500 2.0e-02
malignant mesothelioma 2.800 2.9e-06
osteosarcoma -4.619 2.2e-08
pituitary cancer -1.500 1.1e-02
sonic hedgehog group medulloblastoma 2.800 2.3e-05
tuberculosis 2.100 4.7e-06

Protein-protein Interaction (7)

Gene RIF (11)

AA Sequence

MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLD      1 - 70
EATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAV     71 - 140
KQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGF    141 - 210
KGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQD    211 - 280
QLALDLLSWSKDTYSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYG    281 - 350
NGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF                      351 - 402
//

Text Mined References (29)

PMID Year Title