Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.152 0.000
ovarian cancer 1.400 0.000
psoriasis -1.300 0.000

Synonym

Accession Q8N0V1
Symbols PRED87
C21orf121
NCRNA00318

Gene

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MKDKMWCEDTAQPHRRLPAPPSSSSPTVVFQSHRRLLAPPSSSWTLWVAPRCGCCSPLCPKRVCASLCRV      1 - 70
LAVTWSLTKLPFPLSPILLSRPGWLPQPSSPGPACAEPSSQEGGDTDLRSYGCFVCGWAWPTLSPRP        71 - 137
//

Text Mined References (5)

PMID Year Title
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.