Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.0e-07
osteosarcoma 7950 2.2e-06
psoriasis 6694 1.8e-05

Expression

Synonym

Accession Q8N0V1
Symbols PRED87
C21orf121
NCRNA00318

 Compartment GO Term (0)

AA Sequence

MKDKMWCEDTAQPHRRLPAPPSSSSPTVVFQSHRRLLAPPSSSWTLWVAPRCGCCSPLCPKRVCASLCRV      1 - 70
LAVTWSLTKLPFPLSPILLSRPGWLPQPSSPGPACAEPSSQEGGDTDLRSYGCFVCGWAWPTLSPRP        71 - 137
//

Text Mined References (6)

PMID Year Title