Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.47
PubTator Score 7.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.600 4.2e-02
Atopic dermatitis -1.100 7.0e-04
ductal carcinoma in situ -1.200 5.0e-03
gastric cancer 1.100 1.1e-03
group 4 medulloblastoma 1.200 1.8e-03
hepatocellular carcinoma 1.200 2.0e-06
invasive ductal carcinoma -1.700 6.4e-03
osteosarcoma 1.568 1.6e-03
pancreatic cancer 1.100 4.4e-03
pancreatic carcinoma 1.100 4.4e-03
subependymal giant cell astrocytoma -1.674 2.4e-02
tuberculosis and treatment for 3 months -1.200 1.0e-02

Gene RIF (7)

AA Sequence

MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSAALASRWGRGF      1 - 70
GLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMSVVGSLYLAYILYFVLKEFCI     71 - 140
ICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD                                      141 - 176
//

Text Mined References (22)

PMID Year Title