Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.07
PubTator Score 7.25

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
hepatocellular carcinoma 550 2.01355436938423E-6
tuberculosis and treatment for 6 months 686 2.30276144364884E-4
Atopic dermatitis 944 7.02138453013359E-4
ductal carcinoma in situ 1745 8.52399516004652E-4
gastric cancer 436 0.00107999371761022
osteosarcoma 7933 0.00157070637736335
group 4 medulloblastoma 1875 0.00177992261227172
pancreatic cancer 2300 0.0044101517941983
pancreatic carcinoma 567 0.00441015179419832
invasive ductal carcinoma 2950 0.00642334954638889
subependymal giant cell astrocytoma 2287 0.0235761064555745
acute myeloid leukemia 785 0.0420046592368708
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0
Disease Target Count Z-score Confidence
Chondrodysplasia punctata 41 5.374 2.7


  Differential Expression (12)


PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (6)

24532791 a concerted action of the four conserved cysteines of VKORC1L1 for active site regeneration
23928358 The involvement of VKORC1L1 in VKOR activity partly explains the low susceptibility of some extrahepatic tissues to vitamin K antagonists.
21367861 VKORC1L1 is responsible for driving vitamin K-mediated intracellular antioxidation pathways critical to cell survival.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17996924 VKORC1L1 does not affect the variability of warfarin dose requirement in a Japanese patient population
14765194 molecular cloning

AA Sequence

ICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD                                      141 - 176

Text Mined References (21)

PMID Year Title
26772871 2016 The membrane topology of vitamin K epoxide reductase is conserved between human isoforms and the bacterial enzyme.
26264021 2015 VKORC1 and VKORC1L1: Why do Vertebrates Have Two Vitamin K 2,3-Epoxide Reductases?
26230708 2015 Phylogeny of the Vitamin K 2,3-Epoxide Reductase (VKOR) Family and Evolutionary Relationship to the Disulfide Bond Formation Protein B (DsbB) Family.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24532791 2014 Conserved loop cysteines of vitamin K epoxide reductase complex subunit 1-like 1 (VKORC1L1) are involved in its active site regeneration.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23928358 2013 VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21367861 2011 Human vitamin K 2,3-epoxide reductase complex subunit 1-like 1 (VKORC1L1) mediates vitamin K-dependent intracellular antioxidant function.