Property Summary

NCBI Gene PubMed Count 3
Grant Count 10
R01 Count 4
Funding $2,345,232.9
PubMed Score 47.52
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 2.300 0.000
lung adenocarcinoma -1.300 0.000
nasopharyngeal carcinoma -1.700 0.000
non-small cell lung carcinoma -1.200 0.000
chronic rhinosinusitis -1.680 0.029

AA Sequence

MSSAWKTPRGSDAMPEIMVKIIGSKHFQYLVEKPKIKENDSLKTETQTMHQKPMTDNARQMSRDTPVPIN      1 - 70
FTDQQTTDNPDDVKEKKHPENNQKSENNQKLLTGANSSRFLDGNIPSQANVHCSSVPTGDQSLSYVHGIP     71 - 140
RRKLRDWSLEQMVRGSSDQPEDIGQSPSGTTNEDAFLLALVRRELKSRPLSSNLLEKLQKELKILDPISS    141 - 210
GFLLQSQLSRLFLKHEVPLQLPTVKILCQRFSKRGSPEMVNYEKLLWFLNSAASDYPQQNKAAADLRKTE    211 - 280
SHGTHSQSTPPQHSSSQPEVNRSLLEILKMALRTTNGRLNIDNLNLSFRKEDRSFSGCLPLPKVRAICGK    281 - 350
HGLYLTLSLLETLLNHQDLGYQNEIKWQNFVEMLTRASSDLLSDLPTGKNEKKAPAPPMEPEVPEMSQSK    351 - 420
TEHMKTPEEELQPESSPAETSACKDPLKPLKIRPVSQPFVNPAVKNKAEECETWIDRFRKLENALYLCDL    421 - 490
SNTGVLEKERARRLIHNYNLIYNLSLSPQKIDQALRRFRSGENMLLEPALRYLKEL                  491 - 546
//

Text Mined References (6)

PMID Year Title
25048349 Open reading frames associated with cancer in the dark matter of the human genome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.