Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis 1.100 0.002
psoriasis 2.200 0.000

Synonym

Accession Q8N0U6
Symbols C6orf218

Gene

AA Sequence

MDSSDETGSSFMSFWPHLQSDDLARNGITGFPYFSFIILNESDQILELDGTLVKIWLLVPSHQPATHFKF      1 - 70
EETKTHGPYVITGDYPRSLWQKSASSLPASPPCLWYFLPTLGCFCDHT                           71 - 118
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24906614 2014 Development of a novel noninvasive adhesive patch test for the evaluation of pigmented lesions of the skin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.