Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.0e-58
Atopic dermatitis 952 1.7e-03
Disease Target Count Z-score Confidence
skin melanoma 14 3.755 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
Atopic dermatitis 1.100 1.7e-03
psoriasis 2.200 7.0e-58

AA Sequence

MDSSDETGSSFMSFWPHLQSDDLARNGITGFPYFSFIILNESDQILELDGTLVKIWLLVPSHQPATHFKF      1 - 70
EETKTHGPYVITGDYPRSLWQKSASSLPASPPCLWYFLPTLGCFCDHT                           71 - 118
//

Text Mined References (4)

PMID Year Title