Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N0U4 A8MUR7 B4DQD3 C9IZ91
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPGRRTLKEWTLQ      1 - 70
VSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQA     71 - 140
SVEVNAPLKFGLDIKSSGSGCVKVQSIEGDNCKIETEHGTSILQSVKGQKLHVQTKGGKVICLGTVYGNI    141 - 210
DIHASDKSAVTIDKLQGSSVTVSTEDGLLKAKYLYTESSFLSSAAGDITLGSVHGNITLQSKMGNITVDS    211 - 280
SSGCLKASTNQGAIDVYVSQLGKVELKSHKGSIIVKVPSSLQAHLQLSGKEVDVNSEVHVQEMAEVRKDD    281 - 350
VVTVTGLMNQASKREKWIKADAPKGTVSFRRQSWFQSLKLQD                                351 - 392
//

Text Mined References (7)

PMID Year Title