Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.74
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.400 0.000
glioblastoma -1.800 0.000
medulloblastoma -1.600 0.001
atypical teratoid / rhabdoid tumor -1.200 0.007
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.700 0.000
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.700 0.000

Synonym

Accession Q8N0S2 B2RC80 Q9BWU3 Q9BWU4
Symbols CT76
POF12
SPGF15
C10orf94

Gene

Gene RIF (2)

PMID Text
25899990 A mutation in SYCE1 is associated with non-obstructive azoospermia.
25062452 Given the known function of the SYCE1 gene, we suggest that the nonsense mutation identified accounts for the primary ovarian insufficiency phenotype.

AA Sequence

MAGRSLTSKAEPTAGAVDRAEKAGGQDTSSQKIEDLMEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKA      1 - 70
NKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQETLRILRLHCQEKESEAHRKHTMLQECKERISAL     71 - 140
NLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVK    141 - 210
HQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKE    211 - 280
ELEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKEL    281 - 350
F//

Text Mined References (13)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25899990 2015 Deleterious mutation in SYCE1 is associated with non-obstructive azoospermia.
25416956 2014 A proteome-scale map of the human interactome network.
25062452 2014 Exome sequencing reveals SYCE1 mutation associated with autosomal recessive primary ovarian insufficiency.
24026100 2013 Phylogenies of central element proteins reveal the dynamic evolutionary history of the mammalian synaptonemal complex: ancient and recent components.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15944401 2005 Two novel proteins recruited by synaptonemal complex protein 1 (SYCP1) are at the centre of meiosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...