Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.76
PubTator Score 6.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.500 9.6e-05
Astrocytoma, Pilocytic -1.500 1.8e-07
atypical teratoid / rhabdoid tumor -1.200 7.3e-03
ependymoma -1.200 1.7e-02
glioblastoma -1.400 4.6e-10
group 3 medulloblastoma -1.300 8.3e-03
medulloblastoma, large-cell -1.900 8.3e-05
primitive neuroectodermal tumor -1.700 1.1e-05

Gene RIF (2)

AA Sequence

MAGRSLTSKAEPTAGAVDRAEKAGGQDTSSQKIEDLMEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKA      1 - 70
NKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQETLRILRLHCQEKESEAHRKHTMLQECKERISAL     71 - 140
NLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPERLAKEICALDSSKEQLLKEEKLVKATLEDVK    141 - 210
HQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKE    211 - 280
ELEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKEL    281 - 350
F//

Text Mined References (16)

PMID Year Title