Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.57
PubTator Score 29.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.09563218304708E-15
psoriasis 6685 1.35058323748762E-9
osteosarcoma 7933 1.18361831077849E-5
interstitial cystitis 2299 1.80765563282642E-4
ovarian cancer 8492 2.07690375400953E-4
lung adenocarcinoma 2714 2.63325464488779E-4
diabetes mellitus 1663 0.00106283354735609
colon cancer 1475 0.0101454550815369
inflammatory breast cancer 404 0.0157296659646645
breast carcinoma 1614 0.0274986645430343

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.001 0.000
non-small cell lung cancer 1.862 0.000
colon cancer 2.000 0.010
breast carcinoma -1.400 0.027
diabetes mellitus 1.100 0.001
interstitial cystitis -1.400 0.000
lung adenocarcinoma 2.000 0.000
psoriasis -1.100 0.000
inflammatory breast cancer -2.500 0.016
ovarian cancer -1.100 0.000

Synonym

Accession Q8IZW8 A6NMJ7 Q71RB7 Q8WV64 Q96JV4
Symbols CTEN
PP14434

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (23)

PMID Text
26852686 Conclude that in colorectal cancer, Cten is upregulated by EGFR and Kras but downregulated by STAT3.
26035355 Tensin4 is up-regulated by EGF-induced ERK1/2 activity and promotes cell proliferation and migration in hepatocellular carcinoma
25439778 Cten expression mediates invasion of human lung cancer cells and is upregulated by epidermal growth factor via STAT3.
24814316 Significant correlation between MET and TNS4 expression in human colon carcinoma and ovarian carcinoma suggests TNS4 plays a critical role in MET stability in cancer.
24244691 Findings indicate that induction of Cten protein expression is a relatively early event in melanoma progression, and that Cten has the potential to serve as a prognostic marker for primary melanoma patients.
23774213 CTEN regulates EGFR protein levels through a posttranslational mechanism.
23625726 Up-regulated cten modulates cell migration induced by FGF2.
23500447 Phylogenetic analysis, expression patterns, and transcriptional regulation of human CTEN gene.
22750970 Show an oncogenic role for CTEN in pancreatic cancer through promotion of colony formation and cell motility.
21698197 conclude that, in the colon and pancreas, Cten is a downstream target of Kras and may be a mechanism through which Kras regulates of cell motility
More...

AA Sequence

MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCMGPPGRLQQAP      1 - 70
QVEAKATCFLPSPGEKALGTPEDLDSYIDFSLESLNQMILELDPTFQLLPPGTGGSQAELAQSTMSMRKK     71 - 140
EESEALDIKYIEVTSARSRCHDGPQHCSSPSVTPPFGSLRSGGLLLSRDVPRETRSSSESLIFSGNQGRG    141 - 210
HQRPLPPSEGLSPRPPNSPSISIPCMGSKASSPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVS    211 - 280
DVSYMFGSSQSLLHSSNSSHQSSSRSLESPANSSSSLHSLGSVSLCTRPSDFQAPRNPTLTMGQPRTPHS    281 - 350
PPLAKEHASSCPPSITNSMVDIPIVLINGCPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLS    351 - 420
DAPFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQ    421 - 490
EVPASAQSRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQHSIMALALPCKLTIPQRELG    491 - 560
GADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAVQKAISTTFERDILPTPTVVHFKVTEQGIT    561 - 630
LTDVQRKVFFRRHYPLTTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDMVQPASQ    631 - 700
VIGLVTALLQDAERM                                                           701 - 715
//

Text Mined References (35)

PMID Year Title
26852686 2015 Multiple pathways regulate Cten in colorectal cancer without a Tensin switch.
26035355 2015 Tensin4 is up-regulated by EGF-induced ERK1/2 activity and promotes cell proliferation and migration in hepatocellular carcinoma.
25439778 2015 C-terminal tensin-like protein mediates invasion of human lung cancer cells and is regulated by signal transducer and activator of transcription 3.
24814316 2014 Tensin-4-dependent MET stabilization is essential for survival and proliferation in carcinoma cells.
24244691 2013 C-terminal tensin-like protein is a novel prognostic marker for primary melanoma patients.
23774213 2013 CTEN prolongs signaling by EGFR through reducing its ligand-induced degradation.
23625726 2014 Up-regulated cten by FGF2 contributes to FGF2-mediated cell migration.
23500447 2013 Phylogenetic analysis, expression patterns, and transcriptional regulation of human CTEN gene.
22750970 2013 C-terminal tensin-like gene functions as an oncogene and promotes cell motility in pancreatic cancer.
21698197 2011 Cten is targeted by Kras signalling to regulate cell motility in the colon and pancreas.
More...