Property Summary

NCBI Gene PubMed Count 32
PubMed Score 16.07
PubTator Score 29.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.300 8.0e-04
breast carcinoma -1.400 2.7e-02
colon cancer 1.200 2.4e-02
diabetes mellitus 1.100 1.1e-03
interstitial cystitis -1.100 5.9e-03
lung adenocarcinoma 1.400 3.7e-05
non-small cell lung cancer 1.862 5.1e-15
osteosarcoma 1.001 1.2e-05
ovarian cancer -1.100 2.1e-04
psoriasis -1.100 1.4e-09

Gene RIF (24)

AA Sequence

MSQVMSSPLLAGGHAVSLAPCDEPRRTLHPAPSPSLPPQCSYYTTEGWGAQALMAPVPCMGPPGRLQQAP      1 - 70
QVEAKATCFLPSPGEKALGTPEDLDSYIDFSLESLNQMILELDPTFQLLPPGTGGSQAELAQSTMSMRKK     71 - 140
EESEALDIKYIEVTSARSRCHDGPQHCSSPSVTPPFGSLRSGGLLLSRDVPRETRSSSESLIFSGNQGRG    141 - 210
HQRPLPPSEGLSPRPPNSPSISIPCMGSKASSPHGLGSPLVASPRLEKRLGGLAPQRGSRISVLSASPVS    211 - 280
DVSYMFGSSQSLLHSSNSSHQSSSRSLESPANSSSSLHSLGSVSLCTRPSDFQAPRNPTLTMGQPRTPHS    281 - 350
PPLAKEHASSCPPSITNSMVDIPIVLINGCPEPGSSPPQRTPGHQNSVQPGAASPSNPCPATRSNSQTLS    351 - 420
DAPFTTCPEGPARDMQPTMKFVMDTSKYWFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQ    421 - 490
EVPASAQSRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQHSIMALALPCKLTIPQRELG    491 - 560
GADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAVQKAISTTFERDILPTPTVVHFKVTEQGIT    561 - 630
LTDVQRKVFFRRHYPLTTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTEPQENVCHLFAEYDMVQPASQ    631 - 700
VIGLVTALLQDAERM                                                           701 - 715
//

Text Mined References (36)

PMID Year Title