Property Summary

NCBI Gene PubMed Count 19
PubMed Score 31.28
PubTator Score 16.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical adenoma -1.233 1.4e-02
adrenocortical carcinoma -1.029 3.3e-02
adult high grade glioma 1.300 2.4e-05
aldosterone-producing adenoma -1.684 4.2e-02
astrocytoma 1.100 1.4e-05
Astrocytoma, Pilocytic 1.200 2.0e-05
atypical teratoid / rhabdoid tumor 2.000 2.3e-03
Breast cancer 2.600 4.4e-02
cystic fibrosis -2.110 2.6e-06
ependymoma 1.200 1.7e-03
glioblastoma 1.100 1.9e-03
group 3 medulloblastoma 1.300 2.7e-02
lung carcinoma -1.600 3.3e-14
nasopharyngeal carcinoma -1.200 3.2e-02
non diabetic and post-ischemic heart fai... -1.200 3.9e-03
osteosarcoma 1.426 1.0e-02
ovarian cancer -2.500 4.6e-05
pancreatic ductal adenocarcinoma liver m... -1.058 4.8e-02
pituitary cancer -1.900 2.4e-07
spina bifida -1.819 3.0e-02
type II diabetes mellitus and post-ische... -1.200 1.9e-02

Gene RIF (12)

AA Sequence

MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT      1 - 70
QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS     71 - 140
VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY    141 - 210
CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI    211 - 280
LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI             281 - 341
//

Text Mined References (20)

PMID Year Title