Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.50
PubTator Score 16.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 3.26687135303744E-14
glioblastoma multiforme 347 1.06537667678713E-13
pituitary cancer 1972 6.83885891711397E-8
pilocytic astrocytoma 3086 3.71356867132015E-6
cystic fibrosis 1670 8.77189452873167E-6
astrocytoma 1493 1.42780576548798E-5
adult high grade glioma 2148 4.39726562679892E-5
ovarian cancer 8492 4.58090304963787E-5
group 4 medulloblastoma 1875 7.26008398650878E-4
atypical teratoid / rhabdoid tumor 4369 9.57637189761664E-4
ependymoma 2514 9.86523646086682E-4
non diabetic and post-ischemic heart failure 200 0.00387081516589581
osteosarcoma 7933 0.0100368286197109
adrenocortical adenoma 134 0.0136740440328008
type II diabetes mellitus and post-ischemic heart failure 89 0.0185408460350696
spina bifida 1064 0.030290597794364
nasopharyngeal carcinoma 1056 0.0317649019882539
adrenocortical carcinoma 1427 0.0334805406687461
aldosterone-producing adenoma 664 0.0420711278564739
Breast cancer 3099 0.0440494104325629
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0480956679118442
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Scimitar syndrome 6 3.95 2.0
Fundus Albipunctatus 8 3.883 1.9
Choanal atresia 19 3.494 1.7

Expression

Synonym

Accession Q8IZV5
Symbols SDR16C4

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
25627686 Insulin inhibits retinoic acid biosynthesis through inhibition of FoxO1-induced Rdh10 gene expression.
24733397 Data indicate that retinaldehyde reductase (DHRS3) requires retinol dehydrogenase 10 (RDH10) for full enzymatic activity and, in turn, activates RDH10.
23833249 all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma
21345790 Retinol dehydrogenase 10 but not retinol/sterol dehydrogenase(s) regulates the expression of retinoic acid-responsive genes in human transgenic skin raft culture.
19473719 CYP4Z1, KIR and RDH10 could play a role in non-small-cell lung cancer progression
19102727 wild-type RDH10 catalysed both oxidation of all-trans-retinol and reduction of all-trans-retinal in a cofactor-dependent manner In vitro, however, oxidation is the favoured reaction catalysed by RDH10
18502750 dual physiological role for RDH10: in the biosynthesis of 11-cis-retinaldehyde for vision as well as the biosynthesis of all-trans-retinoic acid for differentiation and development
17218779 Forced over-expression of the RDH10 gene causes growth arrest of HepG2 cells and could be a possible curative strategy for hepatocellular carcinoma.
14596915 organization of the gene includes a unique transcriptional start site, a coding region with six translated exons and a 3' UTR containing at least two used polyadenylation sites.

AA Sequence

MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT      1 - 70
QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS     71 - 140
VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY    141 - 210
CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI    211 - 280
LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI             281 - 341
//

Text Mined References (17)

PMID Year Title
25627686 2015 Insulin regulates retinol dehydrogenase expression and all-trans-retinoic acid biosynthesis through FoxO1.
24733397 2014 The retinaldehyde reductase activity of DHRS3 is reciprocally activated by retinol dehydrogenase 10 to control retinoid homeostasis.
23833249 2013 RDH10, RALDH2, and CRABP2 are required components of PPAR?-directed ATRA synthesis and signaling in human dendritic cells.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21345790 2011 Retinol dehydrogenase 10 but not retinol/sterol dehydrogenase(s) regulates the expression of retinoic acid-responsive genes in human transgenic skin raft culture.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19458327 2009 The 11-cis-retinol dehydrogenase activity of RDH10 and its interaction with visual cycle proteins.
19102727 2009 Characterization of key residues and membrane association domains in retinol dehydrogenase 10.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18502750 2008 Kinetic analysis of human enzyme RDH10 defines the characteristics of a physiologically relevant retinol dehydrogenase.
More...