Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.72
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q8IZV2 A5D6I7 Q8IW01
Symbols CKLFSF8
CKLFSF8-V2

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
26503336 overexpression of CMTM8 in bladder cancer results in reduced malignant cell growth, migration and invasion, which could make it a potential therapeutic target in the treatment of bladder cancer.
25551557 This study identified CMTM8 as a new candidate tumor suppressor gene and GPR177 as a new candidate oncogene in osteosarcoma.
22337876 Down-regulation of CMTM8 also promoted an epithelial mesenchymal transition-like change in MCF-10A cells, indicating a broader role for CMTM8 in regulating cellular transformation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19308021 Observational study of gene-disease association. (HuGE Navigator)
17681841 The cloning and sequencing of an alternative splice form of CMTM8, obtained from a human blood cDNA library, that utilizes apoptotic pathways distinct from CMTM8, is reported.
17149703 These data implicate CMTM8 as a negative regulator of epidermal growth factor (EGF)-induced signaling.
16806010 Cell proliferation and expression of EGFR of tumor cells can be inhibited by transfection of CKLFSF8.
16263120 These results identify CKLFSF8 as a novel regulator of EGF-induced signaling and indicate that the association of EGFR with four transmembrane proteins is critical for EGFR desensitization.
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAF      1 - 70
GWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFN     71 - 140
SWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ                                         141 - 173
//

Text Mined References (21)

PMID Year Title
26615421 2016 Functional characterization of the tumor suppressor CMTM8 and its association with prognosis in bladder cancer.
26574634 2015 CMTM8 is Frequently Downregulated in Multiple Solid Tumors.
26503336 2015 CMTM8 inhibits the carcinogenesis and progression of bladder cancer.
25551557 2014 Focal chromosomal copy number aberrations identify CMTM8 and GPR177 as new candidate driver genes in osteosarcoma.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22337876 2012 Down-regulation of CMTM8 induces epithelial-to-mesenchymal transition-like changes via c-MET/extracellular signal-regulated kinase (ERK) signaling.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...