Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.72
PubTator Score 9.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 1.6e-07
atypical teratoid / rhabdoid tumor 1.100 1.0e-03
ovarian cancer 1.300 4.8e-03
pancreatic ductal adenocarcinoma liver m... -1.055 2.5e-03
pituitary cancer -1.300 5.0e-04

Gene RIF (12)

AA Sequence

MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAF      1 - 70
GWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFN     71 - 140
SWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ                                         141 - 173
//

Text Mined References (21)

PMID Year Title