Property Summary

NCBI Gene PubMed Count 18
PubMed Score 31.87
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.400 6.5e-05
astrocytic glioma -1.800 1.2e-03
Astrocytoma, Pilocytic -3.100 1.8e-11
atypical teratoid / rhabdoid tumor -2.700 6.2e-06
ependymoma -1.500 3.7e-03
glioblastoma -2.300 6.4e-07
group 3 medulloblastoma -1.700 8.7e-03
medulloblastoma, large-cell -2.500 7.9e-05
oligodendroglioma -1.200 7.5e-03
subependymal giant cell astrocytoma -1.875 2.5e-02

Gene RIF (5)

AA Sequence

MKPFQLDLLFVCFFLFSQELGLQKRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCA      1 - 70
IPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPAR     71 - 140
LTVLVPPDDPVILGGPVISLRAGDPLNLTCHADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIVS    141 - 210
TLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNVVTFHCSAKANPAVT    211 - 280
QYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGS    281 - 350
DAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPP    351 - 420
IISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVR    421 - 490
ADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAFLVLMATIVAFCC    491 - 560
ARSQRNLKGVVSAKNDIRVEIVHKEPASGREGEEHSTIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNL    561 - 630
KDPTNGYYSVNTFKEHHSTPTISLSSCQPDLRPAGKQRVPTGMSFTNIYSTLSGQGRLYDYGQRFVLGMG    631 - 700
SSSIELCEREFQRGSLSDSSSFLDTQCDSSVSSSGKQDGYVQFDKASKASASSSHHSQSSSQNSDPSRPL    701 - 770
QRRMQTHV                                                                  771 - 778
//

Text Mined References (18)

PMID Year Title