Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.99
PubTator Score 3.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.400 4.1e-03
aldosterone-producing adenoma -1.254 5.3e-04
Astrocytoma, Pilocytic 2.100 5.6e-08
Atopic dermatitis -1.600 1.6e-03
Breast cancer -1.300 5.3e-04
diabetes mellitus -1.100 3.0e-02
ductal carcinoma in situ -1.500 3.7e-02
glioblastoma 1.600 1.0e-05
group 3 medulloblastoma -2.500 1.4e-04
interstitial cystitis -1.200 3.4e-02
intraductal papillary-mucinous adenoma (... -2.900 1.6e-03
intraductal papillary-mucinous carcinoma... -3.600 6.2e-05
intraductal papillary-mucinous neoplasm ... -2.700 2.2e-02
invasive ductal carcinoma -3.100 1.0e-04
lung carcinoma -2.100 2.4e-20
medulloblastoma, large-cell -3.100 1.2e-04
osteosarcoma 1.217 2.0e-02
ovarian cancer -2.400 1.0e-04

Gene RIF (1)

AA Sequence

MALMFTGHLLFLALLMFAFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSMLHPSLYFDAG      1 - 70
EIQAMRQKSRASHLHLFRAIRSAVTVMLSNPTYYLPPPKHADFAAKWNEIYGNNLPPLALYCLLCPEDKV     71 - 140
AFEFVLEYMDRMVGYKDWLVENAPGDEVPIGHSLTGFATAFDFLYNLLDNHRRQKYLEKIWVITEEMYEY    141 - 210
SKVRSWGKQLLHNHQATNMIALLTGALVTGVDKGSKANIWKQAVVDVMEKTMFLLNHIVDGSLDEGVAYG    211 - 280
SYTAKSVTQYVFLAQRHFNINNLDNNWLKMHFWFYYATLLPGFQRTVGIADSNYNWFYGPESQLVFLDKF    281 - 350
ILKNGAGNWLAQQIRKHRPKDGPMVPSTAQRWSTLHTEYIWYDPQLTPQPPADYGTAKIHTFPNWGVVTY    351 - 420
GAGLPNTQTNTFVSFKSGKLGGRAVYDIVHFQPYSWIDGWRSFNPGHEHPDQNSFTFAPNGQVFVSEALY    421 - 490
GPKLSHLNNVLVFAPSPSSQCNKPWEGQLGECAQWLKWTGEEVGDAAGEIITASQHGEMVFVSGEAVSAY    491 - 560
SSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA    561 - 630
HYKMFWFDHHGNSPMASIQEAEQAAEFKKRWTQFVNVTFQMEPTITRIAYVFYGPYINVSSCRFIDSSNP    631 - 700
GLQISLNVNNTEHVVSIVTDYHNLKTRFNYLGFGGFASVADQGQITRFGLGTQAIVKPVRHDRIIFPFGF    701 - 770
KFNIAVGLILCISLVILTFQWRFYLSFRKLMRWILILVIALWFIELLDVWSTCSQPICAKWTRTEAEGSK    771 - 840
KSLSSEGHHMDLPDVVITSLPGSGAEILKQLFFNSSDFLYIRVPTAYIDIPETELEIDSFVDACEWKVSD    841 - 910
IRSGHFRLLRGWLQSLVQDTKLHLQNIHLHEPNRGKLAQYFAMNKDKKRKFKRRESLPEQRSQMKGAFDR    911 - 980
DAEYIRALRRHLVYYPSARPVLSLSSGSWTLKLHFFQEVLGASMRALYIVRDPRAWIYSMLYNSKPSLYS    981 - 1050
LKNVPEHLAKLFKIEGGKGKCNLNSGYAFEYEPLRKELSKSKSNAVSLLSHLWLANTAAALRINTDLLPT   1051 - 1120
SYQLVKFEDIVHFPQKTTERIFAFLGIPLSPASLNQILFATSTNLFYLPYEGEISPTNTNVWKQNLPRDE   1121 - 1190
IKLIENICWTLMDRLGYPKFMD                                                   1191 - 1212
//

Text Mined References (13)

PMID Year Title