Property Summary

NCBI Gene PubMed Count 27
Grant Count 12
R01 Count 12
Funding $924,683.08
PubMed Score 144.91
PubTator Score 97.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.480 0.000

Gene RIF (19)

PMID Text
25059562 The T657C polymorphism of the SYCP3 gene is possibly associated with recurrent pregnancy loss of unknown cause in human.
24950965 SYCP3 binding and assembly on meiotic chromosomes leads to their organisation into compact structures compatible with recombination and crossover formation
24905095 SCP3 plays an important role in the progression of cervical cancer
23100464 screening for genetic variants in AURKB and SYCP3 among these patients with reproductive problems using Sanger sequencing. Only one apparently non-pathogenic deletion was found in SYCP3.
23069255 Positive synaptonemal complex protein 3 expression is a portent of poor outcome and may be a potential biomarker in the early stages of the non-small cell lung cancer for survival.
22670862 SYCP3 mutations are not associated with the genetic susceptibility for meiotic arrest in infertile male patients with nonobstructive azoospermia in the Turkish population
22197129 mutations in SYCP3 do not contribute significantly to risk for recurrent miscarriage through maternal meiotic nondisjunction.
22116401 Expression of SYCP3 inhibits the homologous recombination (HR) pathway mediated by RAD51.
21357605 The 657T>C mutation of SYCP3 may not be associated with recurrent miscarriage caused by aneuploidy.
21126912 mutation analysis of SYCP3, DNMT3L and MSH4 in patients with maturation arrest of spermatogenesis and couples with recurrent miscarriages; heterozygous change, detected in a conserved functional domain of the SYCP3 gene, was absent in >200 controls
More...

AA Sequence

MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV      1 - 70
QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM     71 - 140
QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM    141 - 210
LQKKIMMETQQQEIASVRKSLQSMLF                                                211 - 236
//

Text Mined References (27)

PMID Year Title
25059562 2014 The T657C polymorphism on the SYCP3 gene is associated with recurrent pregnancy loss.
24950965 2014 A molecular model for the role of SYCP3 in meiotic chromosome organisation.
24905095 2014 Synaptonemal complex protein 3 is a prognostic marker in cervical cancer.
23100464 2013 Mutation screening of AURKB and SYCP3 in patients with reproductive problems.
23069255 2013 Synaptonemal complex protein 3 as a novel prognostic marker in early stage non-small cell lung cancer.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
22670862 2013 Investigation of mutations in the synaptonemal complex protein 3 (SYCP3) gene among azoospermic infertile male patients in the Turkish population.
22197129 2012 Absence of SYCP3 mutations in women with recurrent miscarriage with at least one trisomic miscarriage.
22116401 2011 Synaptonemal complex protein SYCP3 impairs mitotic recombination by interfering with BRCA2.
21357605 2011 SYCP3 mutation may not be associated with recurrent miscarriage caused by aneuploidy.
More...