Property Summary

NCBI Gene PubMed Count 28
PubMed Score 154.38
PubTator Score 97.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.480 1.5e-10

 GO Function (1)

Gene RIF (20)

AA Sequence

MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV      1 - 70
QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM     71 - 140
QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM    141 - 210
LQKKIMMETQQQEIASVRKSLQSMLF                                                211 - 236
//

Text Mined References (28)

PMID Year Title