Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.40
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Disease Target Count Z-score Confidence
Kallmann syndrome 33 3.571 1.8
Uterine fibroid 28 3.412 1.7
Leiomyoma 32 3.095 1.5

Synonym

Accession Q8IZU1 B7ZLH5 Q2M2D1
Symbols TEX39A

Gene

Gene RIF (1)

AA Sequence

MEPVGRKRSRKAAKAQLEAQVTAAQGATKEGSGIASNFPGQPTMEPVGRKRSRKAAKAQLEAQVRAAPAK      1 - 70
KHTGKDPVRDECEERNPFTETREEDVTDEHGEREPFAEKDEHTGIHTMKLEHIAADIKKGLAAKREMIKI     71 - 140
DKAAYRKTKNTIERALKKKQLKRQKRDYRHTRKLLNVLKEYIAEKQKDDEAEEAEAAAAAAEAAAAAEAA    141 - 210
AAAAEVIVVEDEEEEEKEEEEEKEEEEEEGEEEGGGEEGEEGGGGGEGEETEEEEEEEEEEEEEEQIKAF    211 - 280
QEKQKRWQQPTGVRSWRLREMKPLLEQLLKAAKDTKDNYCIISSSEESELDN                      281 - 332
//

Text Mined References (4)

PMID Year Title