Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.64
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 0.034
facioscapulohumeral dystrophy 2.200 0.006

Gene RIF (1)

PMID Text
12213195 Expressed exclusively in testis; protein is located in the nucleus.

AA Sequence

MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM      1 - 70
KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK     71 - 140
WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN                            141 - 186
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22936694 2012 Genome-wide association study identifies a new locus JMJD1C at 10q21 that may influence serum androgen levels in men.
21998597 2011 Genetic determinants of serum testosterone concentrations in men.
21085121 2010 Quantitative reactivity profiling predicts functional cysteines in proteomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213195 2002 A new gene family (FAM9) of low-copy repeats in Xp22.3 expressed exclusively in testis: implications for recombinations in this region.