Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.82
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 6.4e-03
non primary Sjogren syndrome sicca 891 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.200 6.4e-03
non primary Sjogren syndrome sicca -1.100 3.4e-02

Synonym

Accession Q8IZU0 Q0IJ68 Q8N7Z8
Symbols TEX39B

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRM      1 - 70
KMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKK     71 - 140
WQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN                            141 - 186
//

Text Mined References (12)

PMID Year Title