Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.89
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
23836295 FAM9C overexpression increased the phosphorylation levels of Akt and anti-apoptotic ability in hepatocellular carcinoma.
12213195 Expressed exclusively in testis; protein is located in the nucleus.

AA Sequence

MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDI      1 - 70
AADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDG     71 - 140
EKEEQIKIFQEQQKRWQQDGKGTERD                                                141 - 166
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23836295 2013 FAM9C plays an anti-apoptotic role through activation of the PI3K/Akt pathway in human hepatocellular carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213195 2002 A new gene family (FAM9) of low-copy repeats in Xp22.3 expressed exclusively in testis: implications for recombinations in this region.