Property Summary

NCBI Gene PubMed Count 68
PubMed Score 32.71
PubTator Score 104.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Endometrial cancer 311 0.0 0.5
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0
Disease Target Count Z-score Confidence
Microcephaly 166 6.257 3.1
Intellectual disability 1016 4.026 2.0

Expression

  Differential Expression (29)

Disease log2 FC p
Breast cancer 3.500 2.7e-02
adrenocortical carcinoma 3.442 3.9e-05
adult high grade glioma 3.400 1.2e-05
Astrocytoma, Pilocytic 1.700 9.4e-06
Atopic dermatitis 1.900 7.5e-05
atypical teratoid / rhabdoid tumor 4.400 4.7e-12
breast carcinoma 1.800 6.9e-05
colon cancer 1.700 1.0e-03
cystic fibrosis and chronic rhinosinusit... 1.070 4.2e-03
ductal carcinoma in situ 3.000 1.2e-03
Endometriosis 2.224 1.5e-02
ependymoma 2.900 4.5e-08
glioblastoma 4.500 2.7e-12
group 3 medulloblastoma 5.800 1.8e-10
interstitial cystitis 2.100 4.4e-03
intraductal papillary-mucinous carcinoma... 2.600 2.6e-05
intraductal papillary-mucinous neoplasm ... 3.700 2.4e-04
invasive ductal carcinoma 3.900 2.6e-05
lung adenocarcinoma 1.300 2.9e-07
lung cancer 4.500 5.9e-06
medulloblastoma, large-cell 5.100 3.9e-08
nasopharyngeal carcinoma 1.700 1.9e-04
non-small cell lung cancer 3.957 1.6e-40
oligodendroglioma 1.300 3.5e-04
ovarian cancer 1.300 1.5e-04
pancreatic cancer 2.100 5.4e-06
primary Sjogren syndrome 1.500 1.0e-02
primitive neuroectodermal tumor 4.700 2.5e-07
psoriasis 1.700 1.7e-36

 GO Function (1)

 GWAS Trait (1)

Gene RIF (58)

AA Sequence

MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGASRTLSLALDNP      1 - 70
NEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVREIMTFLVNDVLKHQAILLGNA     71 - 140
EEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFSVSQKVDRVRSPLQACENLAMNEGGPPTENN    141 - 210
SLILEENKIPISPISPAFNECHGATCLPLSVRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETS    211 - 280
FNSVNVNGQRGENSKLSLTPNCSSTLNITQSQIHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSQP    281 - 350
VHLESTIAHEIYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS    351 - 420
QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISSHSHNKQPKRR    421 - 490
PILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKEDFHSYLPIIDPILSKSKSYKN    491 - 560
EVTPSSTTASVARKRKSDGSMEDANVRVAITEHTEVREIKRIHFSPSEPKTSAVKKTKNVTTPISKRISN    561 - 630
REKLNLKKKTDLSIFRTPISKTNKRTKPIIAVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQE    631 - 700
QGFTWWLNFILTPDDFTVKTNISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAAC    701 - 770
RLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED    771 - 840
NSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDP    841 - 910
CLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVR    911 - 980
TMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWK    981 - 1050
IAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWV   1051 - 1120
NAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSL   1121 - 1190
DMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL   1191 - 1260
LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVL   1261 - 1330
AQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTI   1331 - 1400
QRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQSQVKATVILQRAFREWHLRKQAKEENSAII   1401 - 1470
IQSWYRMHKELRKYIYIRSCVVIIQKRFRCFQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAA   1471 - 1540
AIQLQAAFRRLKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAV   1541 - 1610
IIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKN   1611 - 1680
ATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRL   1681 - 1750
QRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQL   1751 - 1820
IKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKV   1821 - 1890
RKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKG   1891 - 1960
KTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSA   1961 - 2030
YRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKI   2031 - 2100
QSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQREKYLTILKAV   2101 - 2170
KVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLR   2171 - 2240
HSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQ   2241 - 2310
VQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQH   2311 - 2380
YLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHK   2381 - 2450
LYQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAA   2451 - 2520
KLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRAN   2521 - 2590
KKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRK   2591 - 2660
LTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKT   2661 - 2730
ERKNFLAVQKSVRTIQAAFRGMKVRQKLKNVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKA   2731 - 2800
SGLACSQEAEYHSQSRAAVTIQKAFCRMVTRKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYF   2801 - 2870
RTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQ   2871 - 2940
AMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRK   2941 - 3010
WRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFK   3011 - 3080
KSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRW   3081 - 3150
FRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSW   3151 - 3220
RKKNDCTKIKAIRLSLQVVNREIREENKLYKRTALALHYLLTYKHLSAILEALKHLEVVTRLSPLCCENM   3221 - 3290
AQSGAISKIFVLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNK   3291 - 3360
VADKGGSIFTKTCCLLAILLKTTNRASDVRSRSKVVDRIYSLYKLTAHKHKMNTERILYKQKKNSSISIP   3361 - 3430
FIPETPVRTRIVSRLKPDWVLRRDNMEEITNPLQAIQMVMDTLGIPY                          3431 - 3477
//

Text Mined References (75)

PMID Year Title