Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.63
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adult high grade glioma 3801 1.9e-04
osteosarcoma 7950 3.5e-04
interstitial cystitis 2312 8.2e-03
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.500 1.9e-04
interstitial cystitis 2.100 8.2e-03
osteosarcoma -2.244 3.5e-04

Gene RIF (4)

AA Sequence

MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLSEVSLQKYDCPFSGTSFVV      1 - 70
FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWN     71 - 140
KSQNDCAINNSYLMVIQDITAMVRFNI                                               141 - 167
//

Text Mined References (9)

PMID Year Title