Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $61,767.88
PubMed Score 4.53
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.369 0.000
atypical teratoid / rhabdoid tumor 2.100 0.001
glioblastoma 1.800 0.001
medulloblastoma, large-cell 2.900 0.000
active ulcerative colitis -1.116 0.020
Breast cancer 2.500 0.037
adult high grade glioma 2.000 0.002
group 3 medulloblastoma 1.100 0.006
ovarian cancer 1.300 0.000

Synonym

Accession Q8IZS6
Symbols TCTEX1D3

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
21085971 Because TCTE3 encodes a putative light chain of the outer dynein arm of cilia and human diseases caused by ciliary dysfunction show various phenotypes including skeletal defect, TCTE3 may be a genetic candidate influencing CDH.
21085971 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADI      1 - 70
GKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEF     71 - 140
GYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE                141 - 198
//

Text Mined References (9)

PMID Year Title
26643481 2016 Search for Rare Copy-Number Variants in Congenital Heart Defects Identifies Novel Candidate Genes and a Potential Role for FOXC1 in Patients With Coarctation of the Aorta.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
21085971 2011 Identification of TCTE3 as a gene responsible for congenital diaphragmatic hernia using a high-resolution single-nucleotide polymorphism array.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12584439 2002 Identification of the human ortholog of the t-complex-encoded protein TCTE3 and evaluation as a candidate gene for primary ciliary dyskinesia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278908 2001 The Tctex1/Tctex2 class of dynein light chains. Dimerization, differential expression, and interaction with the LC8 protein family.
1505969 1992 Assignment of the human homologue of the mouse t-complex gene TCTE3 to human chromosome 6q27.