Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.53
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis -1.116 2.0e-02
adult high grade glioma 2.000 2.0e-03
atypical teratoid / rhabdoid tumor 2.100 9.5e-04
Breast cancer 2.500 3.7e-02
glioblastoma 1.800 1.4e-03
group 3 medulloblastoma 1.100 6.4e-03
medulloblastoma, large-cell 2.900 3.4e-06
osteosarcoma -2.369 7.7e-07
ovarian cancer 1.300 2.4e-05

Gene RIF (2)

AA Sequence

MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVEPPFDDSIADI      1 - 70
GKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEF     71 - 140
GYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE                141 - 198
//

Text Mined References (9)

PMID Year Title