Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.29
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (3)

AA Sequence

MEREKFQQKALKQTKQKKSKSAEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLA      1 - 70
AHQQKFRLPASAEPKGNEYGRNYFDPLMDEEINPRQCATEVSREDDDRIFYNRLTKLFDESRQGEPQDES     71 - 140
GREETLNSEAPGSSNKSHEIHKEASEATTAHLEEFQRSQKTIILLGSSPLEQEIRSTSLHCMEDEMSHPW    141 - 210
ILLLKVTAVIRSRRYYREQRF                                                     211 - 231
//

Text Mined References (12)

PMID Year Title