Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.17
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (3)

PMID Text
22507240 Found OFCC1 R129G variant is probably a rare cause of Tourette syndrome/chronic tic phenotype in Chinese Han patients.
20585627 Observational study of gene-disease association. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MEREKFQQKALKQTKQKKSKSAEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLA      1 - 70
AHQQKFRLPASAEPKGNEYGRNYFDPLMDEEINPRQCATEVSREDDDRIFYNRLTKLFDESRQGEPQDES     71 - 140
GREETLNSEAPGSSNKSHEIHKEASEATTAHLEEFQRSQKTIILLGSSPLEQEIRSTSLHCMEDEMSHPW    141 - 210
ILLLKVTAVIRSRRYYREQRF                                                     211 - 231
//

Text Mined References (12)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22507240 2012 Analysis of the MRPL3, DNAJC13 and OFCC1 variants in Chinese Han patients with TS-CTD.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...