Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.88
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (4)

AA Sequence

MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI      1 - 70
CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL     71 - 140
AALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFS    141 - 210
YSTNVTVRKKSPTNLLSLNHWQLA                                                  211 - 234
//

Text Mined References (9)

PMID Year Title