Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.64
PubTator Score 3.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.17592148850701E-7
ovarian cancer 8492 4.85410830632458E-7
pediatric high grade glioma 2712 4.46749171521787E-6
osteosarcoma 7933 1.075036090263E-5
Pick disease 1893 1.4265084778795E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.45163989273983E-5
primitive neuroectodermal tumor 3031 9.62332261823166E-5
glioblastoma 5572 1.58636282529591E-4
ulcerative colitis 2087 2.30904426198422E-4
medulloblastoma, large-cell 6234 3.81594129978923E-4
interstitial cystitis 2299 3.82052289827765E-4
group 3 medulloblastoma 2254 4.65212932237188E-4
head and neck cancer and chronic obstructive pulmonary disease 237 0.00486907917434339
ductal carcinoma in situ 1745 0.00681466664075084
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0118556191262717
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0155972923698283
gastric carcinoma 832 0.0226732352382575
oligodendroglioma 2849 0.0237958066918481
chronic rhinosinusitis 512 0.0285492643293173
ependymoma 2514 0.0335848922457375
primary pancreatic ductal adenocarcinoma 1271 0.0349482805876974
spina bifida 1064 0.0366642971409801

Expression

Synonym

Accession Q8IZR5 Q52M40 Q8IZR4 Q8IZV1
Symbols CKLFSF4

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26474560 CMTM4 is downregulated and exhibits tumour-suppressor activities in clear cell renal cell carcinoma, and could be exploited as a target for clear cell renal cell carcinoma treatment.
20213316 Data show that CMTM4 might be an important gene involved in cell growth and cell cycle regulation.
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI      1 - 70
CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL     71 - 140
AALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFS    141 - 210
YSTNVTVRKKSPTNLLSLNHWQLA                                                  211 - 234
//

Text Mined References (8)

PMID Year Title
26474560 2015 CMTM4 is frequently downregulated and functions as a tumour suppressor in clear cell renal cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20213316 2010 Identification and characterization of CMTM4, a novel gene with inhibitory effects on HeLa cell growth through Inducing G2/M phase accumulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782130 2003 Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.