Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.64
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26474560 CMTM4 is downregulated and exhibits tumour-suppressor activities in clear cell renal cell carcinoma, and could be exploited as a target for clear cell renal cell carcinoma treatment.
20213316 Data show that CMTM4 might be an important gene involved in cell growth and cell cycle regulation.
12782130 Bioinformatics based on CKLF2 cDNA and protein sequences in combination with experimental validation identified CKLFSF1-8 gene clusters, between the SCY and the TM4SF gene families. The 8 family members were cloned and characterized.

AA Sequence

MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFI      1 - 70
CIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVL     71 - 140
AALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFS    141 - 210
YSTNVTVRKKSPTNLLSLNHWQLA                                                  211 - 234
//

Text Mined References (8)

PMID Year Title
26474560 2015 CMTM4 is frequently downregulated and functions as a tumour suppressor in clear cell renal cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20213316 2010 Identification and characterization of CMTM4, a novel gene with inhibitory effects on HeLa cell growth through Inducing G2/M phase accumulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12782130 2003 Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.