Property Summary

NCBI Gene PubMed Count 65
PubMed Score 221.07
PubTator Score 76.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 3.27637093158385E-33
non-small cell lung cancer 2798 7.52206455951767E-16
sonic hedgehog group medulloblastoma 1482 5.74480234538675E-4
cystic fibrosis 1670 0.00121217265305792
Atopic dermatitis 944 0.00173601679247845
Endometriosis 535 0.0197193873135647
interstitial lung disease 292 0.0245610355146313
atypical teratoid/rhabdoid tumor 1095 0.0245982150973369
invasive ductal carcinoma 2950 0.0376773811943185
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Disease Target Count Z-score Confidence
Atherosclerosis 275 3.794 1.9
Heart disease 279 3.128 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.100 0.025
cystic fibrosis -2.789 0.001
Atopic dermatitis -1.400 0.002
non-small cell lung cancer -1.636 0.000
atypical teratoid/rhabdoid tumor 1.100 0.025
sonic hedgehog group medulloblastoma 1.500 0.001
psoriasis -1.500 0.000
Endometriosis -1.440 0.020
invasive ductal carcinoma -1.200 0.038

Synonym

Accession Q8IZQ8 Q5UBU5 Q8N7Q1
Symbols MYCD

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Component (1)

Gene RIF (45)

PMID Text
26244347 Human expression data disclosed correlations of MYOCD with CAV1 in a majority of human tissues and in the heart, correlation with MKL2 (MRTF-B) was observed.
26181633 our study reveals that Ang II downregulates miR-145 to regulate Klf4 and myocardin expression in HCASMCs under high glucose conditions. Ang II plays a critical role in the regulation of miR-145 under hyperglycemic conditions
26129946 inhibition of GSK-3beta reduces myocardin transcriptional activity, suggesting a role for GSK-3beta in myocardin transcriptional activity and smooth muscle differentiation
26100622 STAT3 protein regulates vascular smooth muscle cell phenotypic switch by interaction with myocardin and SRF.
26077572 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25614278 Propose myocardin as a guardian of the contractile, noninflammatory VSMC phenotype, with loss of myocardin representing a critical permissive step in the process of phenotypic transition and inflammatory activation, at the onset of vascular disease.
25384061 TNFalpha differentially regulates myocardin expression and activity
25190111 it is probably that miR135b promotes proliferation, invasion and migration of osteosarcoma cells by degrading myocardin
24681789 Early cardiac marker gene myocardin levels in peripheral blood mononuclear cells reflect severity in stable coronary artery disease.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of myocardin (MYOCD) in primary human brain microvascular endothelial cells
More...

AA Sequence

MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARN      1 - 70
RCNSADLVNMHILQASTAERSIPTAQMKLKRARLADDLNEKIALRPGPLELVEKNILPVDSAVKEAIKGN     71 - 140
QVSFSKSTDAFAFEEDSSSDGLSPDQTRSEDPQNSAGSPPDAKASDTPSTGSLGTNQDLASGSENDRNDS    141 - 210
ASQPSHQSDAGKQGLGPPSTPIAVHAAVKSKSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPP    211 - 280
PMDSAYARLLQQQQLFLQLQILSQQQQQQQHRFSYLGMHQAQLKEPNEQMVRNPNSSSTPLSNTPLSPVK    281 - 350
NSFSGQTGVSSFKPGPLPPNLDDLKVSELRQQLRIRGLPVSGTKTALMDRLRPFQDCSGNPVPNFGDITT    351 - 420
VTFPVTPNTLPNYQSSSSTSALSNGFYHFGSTSSSPPISPASSDLSVAGSLPDTFNDASPSFGLHPSPVH    421 - 490
VCTEESLMSSLNGGSVPSELDGLDSEKDKMLVEKQKVINELTWKLQQEQRQVEELRMQLQKQKRNNCSEK    491 - 560
KPLPFLAASIKQEEAVSSCPFASQVPVKRQSSSSECHPPACEAAQLQPLGNAHCVESSDQTNVLSSTFLS    561 - 630
PQCSPQHSPLGAVKSPQHISLPPSPNNPHFLPSSSGAQGEGHRVSSPISSQVCTAQMAGLHSSDKVGPKF    631 - 700
SIPSPTFSKSSSAISEVTQPPSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRS    701 - 770
SRSPTAVLTKPSASFEQASSGSQIPFDPYATDSDEHLEVLLNSQSPLGKMSDVTLLKIGSEEPHFDGIMD    771 - 840
GFSGKAAEDLFNAHEILPGPLSPMQTQFSPSSVDSNGLQLSFTESPWETMEWLDLTPPNSTPGFSALTTS    841 - 910
SPSIFNIDFLDVTDLNLNSSMDLHLQQW                                              911 - 938
//

Text Mined References (67)

PMID Year Title
26244347 2015 Myocardin Family Members Drive Formation of Caveolae.
26181633 2015 Angiotensin II Downregulates MicroRNA-145 to Regulate Kruppel-like Factor 4 and Myocardin Expression in Human Coronary Arterial Smooth Muscle Cells under High Glucose Conditions.
26129946 2016 Potential Role of Glycogen Synthase Kinase-3? in Regulation of Myocardin Activity in Human Vascular Smooth Muscle Cells.
26100622 2015 STAT3 Protein Regulates Vascular Smooth Muscle Cell Phenotypic Switch by Interaction with Myocardin.
26077572 2015 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25614278 2015 Myocardin regulates vascular smooth muscle cell inflammatory activation and disease.
25416956 2014 A proteome-scale map of the human interactome network.
25384061 2014 Dual regulation of myocardin expression by tumor necrosis factor-? in vascular smooth muscle cells.
25190111 2014 MicroRNA-135b promotes proliferation, invasion and migration of osteosarcoma cells by degrading myocardin.
24681789 Early cardiac gene transcript levels in peripheral blood mononuclear cells reflect severity in stable coronary artery disease.
More...