Property Summary

NCBI Gene PubMed Count 70
PubMed Score 242.67
PubTator Score 76.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.400 1.7e-03
atypical teratoid/rhabdoid tumor 1.100 2.5e-02
cystic fibrosis -2.254 1.1e-04
Endometriosis -1.440 2.0e-02
interstitial lung disease 1.100 2.5e-02
invasive ductal carcinoma -1.200 3.8e-02
non-small cell lung cancer -1.636 7.5e-16
psoriasis -1.200 1.3e-11
sonic hedgehog group medulloblastoma 1.500 5.7e-04

Gene RIF (50)

AA Sequence

MTLLGSEHSLLIRSKFRSVLQLRLQQRRTQEQLANQGIIPPLKRPAEFHEQRKHLDSDKAKNSLKRKARN      1 - 70
RCNSADLVNMHILQASTAERSIPTAQMKLKRARLADDLNEKIALRPGPLELVEKNILPVDSAVKEAIKGN     71 - 140
QVSFSKSTDAFAFEEDSSSDGLSPDQTRSEDPQNSAGSPPDAKASDTPSTGSLGTNQDLASGSENDRNDS    141 - 210
ASQPSHQSDAGKQGLGPPSTPIAVHAAVKSKSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPP    211 - 280
PMDSAYARLLQQQQLFLQLQILSQQQQQQQHRFSYLGMHQAQLKEPNEQMVRNPNSSSTPLSNTPLSPVK    281 - 350
NSFSGQTGVSSFKPGPLPPNLDDLKVSELRQQLRIRGLPVSGTKTALMDRLRPFQDCSGNPVPNFGDITT    351 - 420
VTFPVTPNTLPNYQSSSSTSALSNGFYHFGSTSSSPPISPASSDLSVAGSLPDTFNDASPSFGLHPSPVH    421 - 490
VCTEESLMSSLNGGSVPSELDGLDSEKDKMLVEKQKVINELTWKLQQEQRQVEELRMQLQKQKRNNCSEK    491 - 560
KPLPFLAASIKQEEAVSSCPFASQVPVKRQSSSSECHPPACEAAQLQPLGNAHCVESSDQTNVLSSTFLS    561 - 630
PQCSPQHSPLGAVKSPQHISLPPSPNNPHFLPSSSGAQGEGHRVSSPISSQVCTAQMAGLHSSDKVGPKF    631 - 700
SIPSPTFSKSSSAISEVTQPPSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRS    701 - 770
SRSPTAVLTKPSASFEQASSGSQIPFDPYATDSDEHLEVLLNSQSPLGKMSDVTLLKIGSEEPHFDGIMD    771 - 840
GFSGKAAEDLFNAHEILPGPLSPMQTQFSPSSVDSNGLQLSFTESPWETMEWLDLTPPNSTPGFSALTTS    841 - 910
SPSIFNIDFLDVTDLNLNSSMDLHLQQW                                              911 - 938
//

Text Mined References (72)

PMID Year Title